ACRV1 (NM_020110) Human Mass Spec Standard

CAT#: PH313557

ACRV1 MS Standard C13 and N15-labeled recombinant protein (NP_064495)

Product Images

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC213557
• Predicted MW: 11.2 kDa
• Protein Sequence:
  Sequence Link

  >RC213557 representing NM_020110
  Red=Cloning site Green=Tags(s)
  
  MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGTILNCYTCAYMNDQGKCLRGEGTCITQNS
  QQCMLKKIFEGGKLQFMVQGCENMCPSMNLFSHGTRMQIICCRNQSFCNKI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_064495
• RefSeq Size: 906
• RefSeq ORF: 363
• Synonyms: acrosomal vesicle protein 1; D11S4365; SP-10; SPACA2; sperm protein 10
• Locus ID: 56
• Cytogenetics: 11q24.2
• Summary: This gene encodes a testis-specific, differentiation antigen, acrosomal vesicle protein 1, that arises within the acrosomal vesicle during spermatogenesis, and is associated with the acrosomal membranes and matrix of mature sperm. The acrosomal vesicle protein 1 may be involved in sperm-zona binding or penetration. Alternatively spliced transcript variants have been described. [provided by RefSeq, Nov 2010]
• Protein Families: Druggable Genome