ARL6 (NM_177976) Human Mass Spec Standard

CAT#: PH313584

ARL6 MS Standard C13 and N15-labeled recombinant protein (NP_816931)

Product Images

Coomassie blue staining of purified ARL6 protein (Cat# TP313584). The protein was produced from HEK293T cells transfected with ARL6 cDNA clone (Cat# RC213584) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC213584
• Predicted MW: 21.1 kDa
• Protein Sequence:
  Sequence Link

  >RC213584 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGLLDRLSVLLGLKKKEVHVLCLGLDNSGKTTIINKLKPSNAQSQNILPTIGFSIEKFKSSSLSFTVFDM
  SGQGRYRNLWEHYYKEGQAIIFVIDSSDRLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLRDAVTS
  VKVSQLLCLENIKDKPWHICASDAIKGEGLQEGVDWLQDQIQTVKT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_816931
• RefSeq Size: 1590
• RefSeq ORF: 558
• Synonyms: BBS3; RP55
• Locus ID: 84100
• UniProt ID: Q9H0F7
• Cytogenetics: 3q11.2
• Summary: The protein encoded by this gene belongs to the ARF-like (ADP ribosylation factor-like) sub-family of the ARF family of GTP-binding proteins which are involved in regulation of intracellular traffic. Mutations in this gene are associated with Bardet-Biedl syndrome (BBS). A vision-specific transcript, encoding long isoform BBS3L, has been described (PMID: 20333246). [provided by RefSeq, Apr 2016]