ARL6 (NM_177976) Human Mass Spec Standard
CAT#: PH313584
ARL6 MS Standard C13 and N15-labeled recombinant protein (NP_816931)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC213584 |
Predicted MW | 21.1 kDa |
Protein Sequence |
>RC213584 protein sequence
Red=Cloning site Green=Tags(s) MGLLDRLSVLLGLKKKEVHVLCLGLDNSGKTTIINKLKPSNAQSQNILPTIGFSIEKFKSSSLSFTVFDM SGQGRYRNLWEHYYKEGQAIIFVIDSSDRLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLRDAVTS VKVSQLLCLENIKDKPWHICASDAIKGEGLQEGVDWLQDQIQTVKT myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_816931 |
RefSeq Size | 1590 |
RefSeq ORF | 558 |
Synonyms | BBS3; RP55 |
Locus ID | 84100 |
UniProt ID | Q9H0F7 |
Cytogenetics | 3q11.2 |
Summary | The protein encoded by this gene belongs to the ARF-like (ADP ribosylation factor-like) sub-family of the ARF family of GTP-binding proteins which are involved in regulation of intracellular traffic. Mutations in this gene are associated with Bardet-Biedl syndrome (BBS). A vision-specific transcript, encoding long isoform BBS3L, has been described (PMID: 20333246). [provided by RefSeq, Apr 2016] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406068 | ARL6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC410339 | ARL6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC429797 | ARL6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY406068 | Transient overexpression lysate of ADP-ribosylation factor-like 6 (ARL6), transcript variant 2 |
USD 396.00 |
|
LY410339 | Transient overexpression lysate of ADP-ribosylation factor-like 6 (ARL6), transcript variant 1 |
USD 396.00 |
|
LY429797 | Transient overexpression lysate of ADP-ribosylation factor-like 6 (ARL6), transcript variant 1 |
USD 396.00 |
|
PH305966 | ARL6 MS Standard C13 and N15-labeled recombinant protein (NP_115522) |
USD 2,055.00 |
|
TP305966 | Recombinant protein of human ADP-ribosylation factor-like 6 (ARL6), transcript variant 1 |
USD 823.00 |
|
TP313584 | Recombinant protein of human ADP-ribosylation factor-like 6 (ARL6), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review