ARL6 (NM_032146) Human Recombinant Protein

CAT#: TP305966

Recombinant protein of human ADP-ribosylation factor-like 6 (ARL6), transcript variant 1

Product Images

Coomassie blue staining of purified ARL6 protein (Cat# TP305966). The protein was produced from HEK293T cells transfected with ARL6 cDNA clone (Cat# RC205966) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205966 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGLLDRLSVLLGLKKKEVHVLCLGLDNSGKTTIINKLKPSNAQSQNILPTIGFSIEKFKSSSLSFTVFDM
  SGQGRYRNLWEHYYKEGQAIIFVIDSSDRLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLRDAVTS
  VKVSQLLCLENIKDKPWHICASDAIKGEGLQEGVDWLQDQIQTVKT
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 20.9 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_115522
• Locus ID: 84100
• UniProt ID: Q9H0F7
• Cytogenetics: 3q11.2
• Refseq Size: 1630
• Refseq ORF: 558
• Synonyms: BBS3; RP55
• Summary: The protein encoded by this gene belongs to the ARF-like (ADP ribosylation factor-like) sub-family of the ARF family of GTP-binding proteins which are involved in regulation of intracellular traffic. Mutations in this gene are associated with Bardet-Biedl syndrome (BBS). A vision-specific transcript, encoding long isoform BBS3L, has been described (PMID: 20333246). [provided by RefSeq, Apr 2016]