BEX4 (NM_001080425) Human Mass Spec Standard

CAT#: PH313659

BEX4 MS Standard C13 and N15-labeled recombinant protein (NP_001073894)

Product Images

Coomassie blue staining of purified BEX4 protein (Cat# TP313659). The protein was produced from HEK293T cells transfected with BEX4 cDNA clone (Cat# RC213659) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC213659
• Predicted MW: 13.9 kDa
• Protein Sequence:
  Sequence Link

  >RC213659 representing NM_001080425
  Red=Cloning site Green=Tags(s)
  
  MESKEELAANNLNGENAQQENEGGEQAPTQNEEESRHLGGGEGQKPGGNIRRGRVRRLVPNFRWAIPNRH
  IEHNEARDDVERFVGQMMEIKRKTREQQMRHYMRFQTPEPDNHYDFCLIP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001073894
• RefSeq Size: 1245
• RefSeq ORF: 360
• Synonyms: BEXL1
• Locus ID: 56271
• UniProt ID: Q9NWD9
• Cytogenetics: Xq22.1
• Summary: This gene is a member of the brain expressed X-linked gene family. The proteins encoded by some of the other members of this family act as transcription elongation factors which allow RNA polymerase II to escape pausing during elongation. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Aug 2011]