Ephrin A2 (EFNA2) (NM_001405) Human Mass Spec Standard

CAT#: PH313728

EFNA2 MS Standard C13 and N15-labeled recombinant protein (NP_001396)

Product Images

Coomassie blue staining of purified EFNA2 protein (Cat# TP313728). The protein was produced from HEK293T cells transfected with EFNA2 cDNA clone (Cat# RC213728) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC213728
• Predicted MW: 23.88 kDa
• Protein Sequence:
  Sequence Link

  >RC213728 representing NM_001405
  Red=Cloning site Green=Tags(s)
  
  MAPAQRPLLPLLLLLLPLPPPPFARAEDAARANSDRYAVYWNRSNPRFHAGAGDDGGGYTVEVSINDYLD
  IYCPHYGAPLPPAERMEHYVLYMVNGEGHASCDHRQRGFKRWECNRPAAPGGPLKFSEKFQLFTPFSLGF
  EFRPGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLFLSTIPVLWTL
  LGS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001396
• RefSeq Size: 642
• RefSeq ORF: 639
• Synonyms: ELF-1; EPLG6; HEK7-L; LERK-6; LERK6
• Locus ID: 1943
• UniProt ID: O43921
• Cytogenetics: 19p13.3
• Summary: 'This gene encodes a member of the ephrin family. The protein is composed of a signal sequence, a receptor-binding region, a spacer region, and a hydrophobic region. The EPH and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. Posttranslational modifications determine whether this protein localizes to the nucleus or the cytoplasm. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome
• Protein Pathways: Axon guidance