HOXC6 (NM_004503) Human Mass Spec Standard
CAT#: PH313768
HOXC6 MS Standard C13 and N15-labeled recombinant protein (NP_004494)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC213768 |
Predicted MW | 26.7 kDa |
Protein Sequence |
>RC213768 representing NM_004503
Red=Cloning site Green=Tags(s) MNSYFTNPSLSCHLAGGQDVLPNVALNSTAYDPVRHFSTYGAAVAQNRIYSTPFYSPQENVVFSSSRGPY DYGSNSFYQEKDMLSNCRQNTLGHNTQTSIAQDFSSEQGRTAPQDQKASIQIYPWMQRMNSHSGVGYGAD RRRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKESNLTSTLSGGG GGATADSLGGKEEKREETEEEKQKE myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_004494 |
RefSeq Size | 1681 |
RefSeq ORF | 705 |
Synonyms | CP25; HHO.C8; HOX3; HOX3C |
Locus ID | 3223 |
UniProt ID | P09630 |
Cytogenetics | 12q13.13 |
Summary | 'This gene belongs to the homeobox family, members of which encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene, HOXC6, is one of several HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, share a 5' non-coding exon. Transcripts may include the shared exon spliced to the gene-specific exons, or they may include only the gene-specific exons. Alternatively spliced transcript variants encoding different isoforms have been identified for HOXC6. Transcript variant two includes the shared exon, and transcript variant one includes only gene-specific exons. [provided by RefSeq, Jul 2008]' |
Protein Families | Transcription Factors |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401432 | HOXC6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC403515 | HOXC6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401432 | Transient overexpression lysate of homeobox C6 (HOXC6), transcript variant 1 |
USD 396.00 |
|
LY403515 | Transient overexpression lysate of homeobox C6 (HOXC6), transcript variant 2 |
USD 396.00 |
|
TP313768 | Recombinant protein of human homeobox C6 (HOXC6), transcript variant 1 |
USD 748.00 |
|
TP761182 | Purified recombinant protein of Human homeobox C6 (HOXC6), transcript variant 2n, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review