TCP1 beta (CCT2) (NM_006431) Human Mass Spec Standard

CAT#: PH313873

CCT2 MS Standard C13 and N15-labeled recombinant protein (NP_006422)

Product Images

Coomassie blue staining of purified CCT2 protein (Cat# TP313873). The protein was produced from HEK293T cells transfected with CCT2 cDNA clone (Cat# RC213873) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC213873
• Predicted MW: 57.5 kDa
• Protein Sequence:
  Sequence Link

  >RC213873 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASLSLAPVNIFKAGADEERAETARLTSFIGAIAIGDLVKSTLGPKGMDKILLSSGRDASLMVTNDGATI
  LKNIGVDNPAAKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESLIAKKIHPQTIIAGWREATKAAREA
  LLSSAVDHGSDEVKFRQDLMNIAGTTLSSKLLTHHKDHFTKLAVEAVLRLKGSGNLEAIHIIKKLGGSLA
  DSYLDEGFLLDKKIGVNQPKRIENAKILIANTGMDTDKIKIFGSRVRVDSTAKVAEIEHAEKEKMKEKVE
  RILKHGINCFINRQLIYNYPEQLFGAAGVMAIEHADFAGVERLALVTGGEIASTFDHPELVKLGSCKLIE
  EVMIGEDKLIHFSGVALGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDSRTVYGGGCSEMLMAHA
  VTQLANRTPGKEAVAMESYAKALRMLPTIIADNAGYDSADLVAQLRAAHSEGNTTAGLDMREGTIGDMAI
  LGITESFQVKRQVLLSAAEAAEVILRVDNIIKAAPRKRVPDHHPC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006422
• RefSeq Size: 1962
• RefSeq ORF: 1605
• Synonyms: 99D8.1; CCT-beta; CCTB; HEL-S-100n; PRO1633; TCP-1-beta
• Locus ID: 10576
• UniProt ID: P78371, V9HW96
• Cytogenetics: 12q15
• Summary: The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2010]
• Protein Families: Druggable Genome