MAGED2 (NM_201222) Human Mass Spec Standard
CAT#: PH314066
MAGED2 MS Standard C13 and N15-labeled recombinant protein (NP_957516)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC214066 |
Predicted MW | 65 kDa |
Protein Sequence |
>RC214066 protein sequence
Red=Cloning site Green=Tags(s) MSDTSESGAGLTRFQAEASEKDSSSMMQTLLTVTQNVEVPETPKASKALEVSEDVKVSKASGVSKATEVS KTPEAREAPATQASSTTQLTDTQVLAAENKSLAADTKKQNADPQAVTMPATETKKVSHVADTKVNTKAQE TEAAPSQAPADEPEPESAAAQSQENQDTRPKVKAKKARKVKHLDGEEDGSSDQSQASGTTGGRRVSKALM ASMARRASRGPIAFWARRASRTRLAAWARRALLSLRSPKARRGKARRRAAKLQSSQEPEAPPPRDVALLQ GRANDLVKYLLAKDQTKIPIKRSDMLKDIIKEYTDVYPEIIERAGYSLEKVFGIQLKEIDKNDHLYILLS TLEPTDAGILGTTKDSPKLGLLMVLLSIIFMNGNRSSEAVIWEVLRKLGLRPGIHHSLFGDVKKLITDEF VKQKYLDYARVPNSNPPEYEFFWGLRSYYETSKMKVLKFACKVQKKDPKEWAAQYREAMEADLKAAAEAA AEAKARAEIRARMGIGLGSENAAGPCNWDEADIGPWAKARIQAGAEAKAKAQESGSASTGASTSTNNSAS ASASTSGGFSAGASLTATLTFGLFAGLGGAGASTSGSSGACGFSYK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_957516 |
RefSeq Size | 2176 |
RefSeq ORF | 1818 |
Synonyms | 11B6; BARTS5; BCG-1; BCG1; HCA10; MAGE-D2 |
Locus ID | 10916 |
UniProt ID | Q9UNF1, A0A024R9Y7 |
Cytogenetics | Xp11.21 |
Summary | This gene is a member of the MAGED gene family. The MAGED genes are clustered on chromosome Xp11. This gene is located in Xp11.2, a hot spot for X-linked intellectual disability (XLID). Mutations in this gene cause a form of transient antenatal Bartter's syndrome. This gene may also be involved in several types of cancer, including breast cancer and melanoma. The protein encoded by this gene is progressively recruited from the cytoplasm to the nucleoplasm during the interphase and after nucleolar stress and is thus thought to play a role in cell cycle regulation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2017] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404585 | MAGED2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC406162 | MAGED2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC415179 | MAGED2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430465 | MAGED2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430842 | MAGED2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY404585 | Transient overexpression lysate of melanoma antigen family D, 2 (MAGED2), transcript variant 3 |
USD 605.00 |
|
LY406162 | Transient overexpression lysate of melanoma antigen family D, 2 (MAGED2), transcript variant 2 |
USD 605.00 |
|
LY415179 | Transient overexpression lysate of melanoma antigen family D, 2 (MAGED2), transcript variant 1 |
USD 396.00 |
|
LY430465 | Transient overexpression lysate of melanoma antigen family D, 2 (MAGED2), transcript variant 2 |
USD 396.00 |
|
LY430842 | Transient overexpression lysate of melanoma antigen family D, 2 (MAGED2), transcript variant 3 |
USD 396.00 |
|
PH301748 | MAGED2 MS Standard C13 and N15-labeled recombinant protein (NP_055414) |
USD 2,055.00 |
|
PH319260 | MAGED2 MS Standard C13 and N15-labeled recombinant protein (NP_803182) |
USD 2,055.00 |
|
TP301748 | Recombinant protein of human melanoma antigen family D, 2 (MAGED2), transcript variant 1 |
USD 867.00 |
|
TP314066 | Recombinant protein of human melanoma antigen family D, 2 (MAGED2), transcript variant 3 |
USD 748.00 |
|
TP319260 | Recombinant protein of human melanoma antigen family D, 2 (MAGED2), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review