AARD (NM_001025357) Human Mass Spec Standard

CAT#: PH314088

C8orf85 MS Standard C13 and N15-labeled recombinant protein (NP_001020528)

Product Images

Coomassie blue staining of purified AARD protein (Cat# TP314088). The protein was produced from HEK293T cells transfected with AARD cDNA clone (Cat# RC214088) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC214088
• Predicted MW: 17.4 kDa
• Protein Sequence:
  Sequence Link

  >RC214088 representing NM_001025357
  Red=Cloning site Green=Tags(s)
  
  MGPGDFRRCRERISQGLQGLPGRAELWFPPRPACDFFGDGRSTDIQEEALAASPLLEDLRRRLTRAFQWA
  VQRAISRRVQEAAAAAAAREEQSWTGVEATLARLRAELVEMHFQNHQLARTLLDLNMKVQQLKKEYELEI
  TSDSQSPKDDAANPE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001020528
• RefSeq Size: 751
• RefSeq ORF: 465
• Synonyms: C8orf85
• Locus ID: 441376
• UniProt ID: Q4LEZ3, B2RU19
• Cytogenetics: 8q24.11