Hemogen (HEMGN) (NM_197978) Human Mass Spec Standard

CAT#: PH314122

HEMGN MS Standard C13 and N15-labeled recombinant protein (NP_932095)

Product Images

Coomassie blue staining of purified HEMGN protein (Cat# TP314122). The protein was produced from HEK293T cells transfected with HEMGN cDNA clone (Cat# RC214122) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC214122
• Predicted MW: 55.3 kDa
• Protein Sequence:
  Sequence Link

  >RC214122 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDLGKDQSHLKHHQTPDPHQEENHSPEVIGTWSLRNRELLRKRKAEVHEKETSQWLFGEQKKRKQQRTGK
  GNRRGRKRQQNTELKVEPQPQIEKEMEKALAPIEKKTEPPGSITKVFPSVASPQKVVPEEHFSEICQESN
  IYQENFSEYQEIAVQNHSSETCQHVSEPEDLSPKMYQEISVLQDNSSKICQDMKEPEDNSPNTCQVISVI
  QDHPFKMYQDMAKREDLAPKMCQEAAVPKILPCPTSEDTADLAGCSLQAYPKPDVPKGYILDTDQNPAEP
  EEYNETDQGIAETEGLFPKIQEIAEPKDLSTKTHQESAEPKYLPHKTCNEIIVPKAPSHKTIQETPHSED
  YSIEINQETPGSEKYSPETYQEIPGLEEYSPEIYQETSQLEEYSPEIYQETPGPEDLSTETYKNKDVPKE
  CFPEPHQETGGPQGQDPKAHQEDAKDAYTFPQEMKEKPKEEPGIPAILNESHPENDVYSYVLF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_932095
• RefSeq Size: 2306
• RefSeq ORF: 254
• Synonyms: CT155; EDAG; EDAG-1; NDR
• Locus ID: 55363
• UniProt ID: Q9BXL5, A0A024R162
• Cytogenetics: 9q22.33
• Summary: Regulates the proliferation and differentiation of hematopoietic cells. Overexpression block the TPA-induced megakaryocytic differentiation in the K562 cell model. May also prevent cell apoptosis through the activation of the nuclear factor-kappa B (NF-kB). [UniProtKB/Swiss-Prot Function]