CCBL2 (KYAT3) (NM_001008661) Human Mass Spec Standard

CAT#: PH314155

CCBL2 MS Standard C13 and N15-labeled recombinant protein (NP_001008661)

Product Images

Coomassie blue staining of purified KYAT3 protein (Cat# TP314155). The protein was produced from HEK293T cells transfected with KYAT3 cDNA clone (Cat# RC214155) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC214155
• Predicted MW: 51.2 kDa
• Protein Sequence:
  Sequence Link

  >RC214155 representing NM_001008661
  Red=Cloning site Green=Tags(s)
  
  MFLAQRSLCSLSGRAKFLKTISSSKILGFSTSAKMSLKFTNAKRIEGLDSNVWIEFTKLAADPSVVNLGQ
  GFPDISPPTYVKEELSKIAAIDSLNQYTRGFGHPSLVKALSYLYEKLYQKQIDSNKEILVTVGAYGSLFN
  TIQALIDEGDEVILIVPFYDCYEPMVRMAGATPVFIPLRSKPVYGKRWSSSDWTLDPQELESKFNSKTKA
  IILNTPHNPLGKVYNREELQVIADLCIKYDTLCISDEVYEWLVYSGNKHLKIATFPGMWERTITIGSAGK
  TFSVTGWKLGWSIGPNHLIKHLQTVQQNTIYTCATPLQEALAQAFWIDIKRMDDPECYFNSLPKELEVKR
  DRMVRLLESVGLKPIVPDGGYFIIADVSLLDPDLSDMKNNEPYDYKFVKWMTKHKKLSAIPVSAFCNSET
  KSQFEKFVRFCFIKKDSTLDAAEEIIKAWSVQKS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001008661
• RefSeq Size: 2038
• RefSeq ORF: 1362
• Synonyms: CCBL2; KAT3; KATIII
• Locus ID: 56267
• UniProt ID: Q6YP21, B4DW13
• Cytogenetics: 1p22.2
• Summary: This gene encodes an aminotransferase that transaminates kynurenine to form kynurenic acid, which is a metabolite of tryptophan. Multiple alternatively spliced transcript variants that encode different proteins have been described for this gene. This gene shares 5' exon structure with the RNA binding motif protein, X-linked-like 1 locus on chromosome 1, but the coding sequences are non-overlapping. [provided by RefSeq, Mar 2017]