KLC2 (NM_022822) Human Mass Spec Standard
CAT#: PH314206
KLC2 MS Standard C13 and N15-labeled recombinant protein (NP_073733)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC214206 |
Predicted MW | 68.8 kDa |
Protein Sequence |
>RC214206 representing NM_022822
Red=Cloning site Green=Tags(s) MAMMVFPREEKLSQDEIVLGTKAVIQGLETLRGEHRALLAPLVAPEAGEAEPGSQERCILLRRSLEAIEL GLGEAQVILALSSHLGAVESEKQKLRAQVRRLVQENQWLREELAGTQQKLQRSEQAVAQLEEEKQHLLFM SQIRKLDEDASPNEEKGDVPKDTLDDLFPNEDEQSPAPSPGGGDVSGQHGGYEIPARLRTLHNLVIQYAS QGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALAIREKTLGKDHPA VAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKFHPDVAKQLSNLALLCQNQGKAEEVEYYYRRA LEIYATRLGPDDPNVAKTKNNLASCYLKQGKYQDAETLYKEILTRAHEKEFGSVNGDNKPIWMHAEEREE SKDKRRDSAPYGEYGSWYKACKVDSPTVNTTLRSLGALYRRQGKLEAAHTLEDCASRNRKQGLDPASQTK VVELLKDGSGRRGDRRSSRDMAGGAGPRSESDLEDVGPTAEWNGDGSGSLRRSGSFGKLRDALRRSSEML VKKLQGGTPQEPPNPRMKRASSLNFLNKSVEEPTQPGGTGLSDSRTLSSSSMDLSRRSSLVG myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_073733 |
RefSeq Size | 2992 |
RefSeq ORF | 1866 |
Synonyms | SPOAN |
Locus ID | 64837 |
UniProt ID | Q9H0B6 |
Cytogenetics | 11q13.2 |
Summary | The protein encoded by this gene is a light chain of kinesin, a molecular motor responsible for moving vesicles and organelles along microtubules. Defects in this gene are a cause of spastic paraplegia, optic atrophy, and neuropathy (SPOAN) syndrome. [provided by RefSeq, Mar 2016] |
Protein Families | Druggable Genome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402950 | KLC2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC427490 | KLC2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC427491 | KLC2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC427492 | KLC2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402950 | Transient overexpression lysate of kinesin light chain 2 (KLC2), transcript variant 1 |
USD 396.00 |
|
LY427490 | Transient overexpression lysate of kinesin light chain 2 (KLC2), transcript variant 2 |
USD 396.00 |
|
LY427491 | Transient overexpression lysate of kinesin light chain 2 (KLC2), transcript variant 3 |
USD 396.00 |
|
LY427492 | Transient overexpression lysate of kinesin light chain 2 (KLC2), transcript variant 4 |
USD 396.00 |
|
PH326034 | KLC2 MS Standard C13 and N15-labeled recombinant protein (NP_001128247) |
USD 2,055.00 |
|
PH326035 | KLC2 MS Standard C13 and N15-labeled recombinant protein (NP_001128248) |
USD 2,055.00 |
|
TP314206 | Recombinant protein of human kinesin light chain 2 (KLC2), transcript variant 1 |
USD 748.00 |
|
TP326034 | Recombinant protein of human kinesin light chain 2 (KLC2), transcript variant 3 |
USD 748.00 |
|
TP326035 | Recombinant protein of human kinesin light chain 2 (KLC2), transcript variant 4 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review