Aminomethyltransferase (AMT) (NM_000481) Human Mass Spec Standard

CAT#: PH314343

AMT MS Standard C13 and N15-labeled recombinant protein (NP_000472)

Product Images

Coomassie blue staining of purified AMT protein (Cat# TP314343). The protein was produced from HEK293T cells transfected with AMT cDNA clone (Cat# RC214343) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC214343
• Predicted MW: 43.8 kDa
• Protein Sequence:
  Sequence Link

  >RC214343 representing NM_000481
  Red=Cloning site Green=Tags(s)
  
  MQRAVSVVARLGFRLQAFPPALCRPLSCAQEVLRRTPLYDFHLAHGGKMVAFAGWSLPVQYRDSHTDSHL
  HTRQHCSLFDVSHMLQTKILGSDRVKLMESLVVGDIAELRPNQGTLSLFTNEAGGILDDLIVTNTSEGHL
  YVVSNAGCWEKDLALMQDKVRELQNQGRDVGLEVLDNALLALQGPTAAQVLQAGVADDLRKLPFMTSAVM
  EVFGVSGCRVTRCGYTGEDGVEISVPVAGAVHLATAILKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEH
  TTPVEGSLSWTLGKRRRAAMDFPGAKVIVPQLKGRVQRRRVGLMCEGAPMRAHSPILNMEGTKIGTVTSG
  CPSPSLKKNVAMGYVPCEYSRPGTMLLVEVRRKQQMAVVSKMPFVPTNYYTLK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000472
• RefSeq Size: 2117
• RefSeq ORF: 1209
• Synonyms: GCE; GCST; GCVT; NKH
• Locus ID: 275
• UniProt ID: P48728, A0A024R2U7
• Cytogenetics: 3p21.31
• Summary: 'This gene encodes one of four critical components of the glycine cleavage system. Mutations in this gene have been associated with glycine encephalopathy. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011]'
• Protein Pathways: Glycine, serine and threonine metabolism, Metabolic pathways, Nitrogen metabolism, One carbon pool by folate