Aminomethyltransferase (AMT) (NM_000481) Human Mass Spec Standard
CAT#: PH314343
AMT MS Standard C13 and N15-labeled recombinant protein (NP_000472)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC214343 |
Predicted MW | 43.8 kDa |
Protein Sequence |
>RC214343 representing NM_000481
Red=Cloning site Green=Tags(s) MQRAVSVVARLGFRLQAFPPALCRPLSCAQEVLRRTPLYDFHLAHGGKMVAFAGWSLPVQYRDSHTDSHL HTRQHCSLFDVSHMLQTKILGSDRVKLMESLVVGDIAELRPNQGTLSLFTNEAGGILDDLIVTNTSEGHL YVVSNAGCWEKDLALMQDKVRELQNQGRDVGLEVLDNALLALQGPTAAQVLQAGVADDLRKLPFMTSAVM EVFGVSGCRVTRCGYTGEDGVEISVPVAGAVHLATAILKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEH TTPVEGSLSWTLGKRRRAAMDFPGAKVIVPQLKGRVQRRRVGLMCEGAPMRAHSPILNMEGTKIGTVTSG CPSPSLKKNVAMGYVPCEYSRPGTMLLVEVRRKQQMAVVSKMPFVPTNYYTLK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000472 |
RefSeq Size | 2117 |
RefSeq ORF | 1209 |
Synonyms | GCE; GCST; GCVT; NKH |
Locus ID | 275 |
UniProt ID | P48728, A0A024R2U7 |
Cytogenetics | 3p21.31 |
Summary | 'This gene encodes one of four critical components of the glycine cleavage system. Mutations in this gene have been associated with glycine encephalopathy. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011]' |
Protein Pathways | Glycine, serine and threonine metabolism, Metabolic pathways, Nitrogen metabolism, One carbon pool by folate |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424691 | AMT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC431304 | AMT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC431317 | AMT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC431336 | AMT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY424691 | Transient overexpression lysate of aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 396.00 |
|
LY431304 | Transient overexpression lysate of aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 3 |
USD 396.00 |
|
LY431317 | Transient overexpression lysate of aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 396.00 |
|
LY431336 | Transient overexpression lysate of aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 4 |
USD 396.00 |
|
TP314343 | Recombinant protein of human aminomethyltransferase (AMT) |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review