DUSP27 (DUPD1) (NM_001003892) Human Mass Spec Standard

CAT#: PH314361

DUPD1 MS Standard C13 and N15-labeled recombinant protein (NP_001003892)

Product Images

Coomassie blue staining of purified DUPD1 protein (Cat# TP314361). The protein was produced from HEK293T cells transfected with DUPD1 cDNA clone (Cat# RC214361) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC214361
• Predicted MW: 25.2 kDa
• Protein Sequence:
  Sequence Link

  >RC214361 representing NM_001003892
  Red=Cloning site Green=Tags(s)
  
  MTSGEVKTSLKNAYSSAKRLSPKMEEEGEEEDYCTPGAFELERLFWKGSPQYTHVNEVWPKLYIGDEATA
  LDRYRLQKAGFTHVLNAAHGRWNVDTGPDYYRDMDIQYHGVEADDLPTFDLSVFFYPAAAFIDRALSDDH
  SKILVHCVMGRSRSATLVLAYLMIHKDMTLVDAIQQVAKNRCVLPNRGFLKQLRELDKQLVQQRRRSQRQ
  DGEEEDGREL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001003892
• RefSeq Size: 663
• RefSeq ORF: 660
• Synonyms: DUPD1; DUSP27; FMDSP
• Locus ID: 338599
• UniProt ID: Q68J44
• Cytogenetics: 10q22.2
• Summary: Dual specificity phosphatase able to dephosphorylate phosphotyrosine, phosphoserine and phosphothreonine residues, with a preference for phosphotyrosine as a substrate. [UniProtKB/Swiss-Prot Function]
• Protein Families: Phosphatase