PHOSPHO1 (NM_178500) Human Mass Spec Standard

CAT#: PH314434

PHOSPHO1 MS Standard C13 and N15-labeled recombinant protein (NP_848595)

Product Images

Coomassie blue staining of purified PHOSPHO1 protein (Cat# TP314434). The protein was produced from HEK293T cells transfected with PHOSPHO1 cDNA clone (Cat# RC214434) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC214434
• Predicted MW: 29.7 kDa
• Protein Sequence:
  Sequence Link

  >RC214434 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSGCFPVSGLRCLSRDGRMAAQGAPRFLLTFDFDETIVDENSDDSIVRAAPGQRLPESLRATYREGFYNE
  YMQRVFKYLGEQGVRPRDLSAIYEAIPLSPGMSDLLQFVAKQGACFEVILISDANTFGVESSLRAAGHHS
  LFRRILSNPSGPDARGLLALRPFHTHSCARCPANMCKHKVLSDYLRERAHDGVHFERLFYVGDGANDFCP
  MGLLAGGDVAFPRRGYPMHRLIQEAQKAEPSSFRASVVPWETAADVRLHLQQVLKSC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_848595
• RefSeq Size: 2046
• RefSeq ORF: 801
• Synonyms: phosphatase, orphan 1; phosphoethanolamine/phosphocholine phosphatase
• Locus ID: 162466
• UniProt ID: Q8TCT1
• Cytogenetics: 17q21.32
• Summary: Phosphatase that has a high activity toward phosphoethanolamine (PEA) and phosphocholine (PCho). Involved in the generation of inorganic phosphate for bone mineralization. [UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome
• Protein Pathways: Glycerophospholipid metabolism