NPL (NM_030769) Human Mass Spec Standard
CAT#: PH314546
NPL MS Standard C13 and N15-labeled recombinant protein (NP_110396)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC214546 |
Predicted MW | 35.2 kDa |
Protein Sequence |
>RC214546 protein sequence
Red=Cloning site Green=Tags(s) MAFPKKKLQGLVAATITPMTENGEINFSVIGQYVDYLVKEQGVKNIFVNGTTGEGLSLSVSERRQVAEEW VTKGKDKLDQVIIHVGALSLKESQELAQHAAEIGADGIAVIAPFFLKPWTKDILINFLKEVAAAAPALPF YYYHIPALTGVKIRAEELLDGILDKIPTFQGLKFSDTDLLDFGQCVDQNRQQQFAFLFGVDEQLLSALVM GATGAVGSTYNYLGKKTNQMLEAFEQKDFSLALNYQFCIQRFINFVVKLGFGVSQTKAIMTLVSGIPMGP PRLPLQKASREFTDSAEAKLKSLDFLSFTDLKDGNLEAGS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_110396 |
RefSeq Size | 2867 |
RefSeq ORF | 960 |
Synonyms | C1orf13; C112; NAL; NPL1 |
Locus ID | 80896 |
UniProt ID | Q9BXD5 |
Cytogenetics | 1q25.3 |
Summary | This gene encodes a member of the N-acetylneuraminate lyase sub-family of (beta/alpha)(8)-barrel enzymes. N-acetylneuraminate lyases regulate cellular concentrations of N-acetyl-neuraminic acid (sialic acid) by mediating the reversible conversion of sialic acid into N-acetylmannosamine and pyruvate. A pseudogene of this gene is located on the short arm of chromosome 2. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2011] |
Protein Pathways | Amino sugar and nucleotide sugar metabolism |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410719 | NPL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY410719 | Transient overexpression lysate of N-acetylneuraminate pyruvate lyase (dihydrodipicolinate synthase) (NPL) |
USD 325.00 |
|
TP314546 | Recombinant protein of human N-acetylneuraminate pyruvate lyase (dihydrodipicolinate synthase) (NPL) |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review