OTC (Ornithine Carbamoyltransferase (OTC)) (NM_000531) Mass Spec Standard

CAT#: PH314662

OTC MS Standard C13 and N15-labeled recombinant protein (NP_000522)

Specifications

Product Data

• Tag: C-Myc/DDK
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC214662
• Predicted MW: 39.94 kDa
• Protein Sequence:
  Sequence Link

  >RC214662 representing NM_000531
  Red=Cloning site Green=Tags(s)
  
  MLFNLRILLNNAAFRNGHNFMVRNFRCGQPLQNKVQLKGRDLLTLKNFTGEEIKYMLWLSADLKFRIKQK
  GEYLPLLQGKSLGMIFEKRSTRTRLSTETGFALLGGHPCFLTTQDIHLGVNESLTDTARVLSSMADAVLA
  RVYKQSDLDTLAKEASIPIINGLSDLYHPIQILADYLTLQEHYSSLKGLTLSWIGDGNNILHSIMMSAAK
  FGMHLQAATPKGYEPDASVTKLAEQYAKENGTKLLLTNDPLEAAHGGNVLITDTWISMGQEEEKKKRLQA
  FQGYQVTMKTAKVAASDWTFLHCLPRKPEEVDDEVFYSPRSLVFPEAENRKWTIMAVMVSLLTDYSPQLQ
  KPKF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: > 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000522
• RefSeq Size: 1927
• RefSeq ORF: 1062
• Synonyms: OCTD
• Locus ID: 5009
• UniProt ID: P00480
• Cytogenetics: Xp11.4
• Summary: 'This nuclear gene encodes a mitochondrial matrix enzyme. Missense, nonsense, and frameshift mutations in this enzyme lead to ornithine transcarbamylase deficiency, which causes hyperammonemia. Since the gene for this enzyme maps close to that for Duchenne muscular dystrophy, it may play a role in that disease also. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome
• Protein Pathways: Arginine and proline metabolism, Metabolic pathways