ZNHIT3 (NM_004773) Human Mass Spec Standard

CAT#: PH314666

ZNHIT3 MS Standard C13 and N15-labeled recombinant protein (NP_004764)

Product Images

Coomassie blue staining of purified ZNHIT3 protein (Cat# TP314666). The protein was produced from HEK293T cells transfected with ZNHIT3 cDNA clone (Cat# RC214666) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC214666
• Predicted MW: 17.6 kDa
• Protein Sequence:
  Sequence Link

  >RC214666 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASLKCSTVVCVICLEKPKYRCPACRVPYCSVVCFRKHKEQCNPETRPVEKKIRSALPTKTVKPVENKDD
  DDSIADFLNSDEEEDRVSLQNLKNLGESATLRSLLLNPHLRQLMVNLDQGEDKAKLMRAYMQEPLFVEFA
  DCCLGIVEPSQNEES
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004764
• RefSeq Size: 974
• RefSeq ORF: 465
• Synonyms: PEHO; TRIP3
• Locus ID: 9326
• UniProt ID: Q15649, A0A024R0X8
• Cytogenetics: 17q12
• Protein Families: Druggable Genome, Transcription Factors