HMGA2 (NM_003484) Human Mass Spec Standard

CAT#: PH314681

HMGA2 MS Standard C13 and N15-labeled recombinant protein (NP_003475)

Product Images

Coomassie blue staining of purified HMGA2 protein (Cat# TP314681). The protein was produced from HEK293T cells transfected with HMGA2 cDNA clone (Cat# RC214681) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC214681
• Predicted MW: 11.3 kDa
• Protein Sequence:
  Sequence Link

  >RC214681 representing NM_003484
  Red=Cloning site Green=Tags(s)
  
  MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRGRPKGSKNKSPSKAAQKKAEA
  TGEKRPRGRPRKWDNLLPRTSSKKKTSLGNSTKRSH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003475
• RefSeq Size: 1539
• RefSeq ORF: 318
• Synonyms: BABL; HMGI-C; HMGIC; LIPO; STQTL9
• Locus ID: 8091
• UniProt ID: P52926
• Cytogenetics: 12q14.3
• Summary: This gene encodes a protein that belongs to the non-histone chromosomal high mobility group (HMG) protein family. HMG proteins function as architectural factors and are essential components of the enhancesome. This protein contains structural DNA-binding domains and may act as a transcriptional regulating factor. Identification of the deletion, amplification, and rearrangement of this gene that are associated with myxoid liposarcoma suggests a role in adipogenesis and mesenchymal differentiation. A gene knock out study of the mouse counterpart demonstrated that this gene is involved in diet-induced obesity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome