HSPB2 (NM_001541) Human Mass Spec Standard

CAT#: PH314718

HSPB2 MS Standard C13 and N15-labeled recombinant protein (NP_001532)

Product Images

Coomassie blue staining of purified HSPB2 protein (Cat# TP314718). The protein was produced from HEK293T cells transfected with HSPB2 cDNA clone (Cat# RC214718) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC214718
• Predicted MW: 20.2 kDa
• Protein Sequence:
  Sequence Link

  >RC214718 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLS
  EGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDG
  ILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIVEP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001532
• RefSeq Size: 858
• RefSeq ORF: 546
• Synonyms: Hs.78846; HSP27; LOH11CR1K; MKBP
• Locus ID: 3316
• UniProt ID: Q16082, A8KAH6
• Cytogenetics: 11q23.1
• Summary: 'The protein encoded by this gene belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain at the C-terminal part of the molecule. The protein is expressed preferentially in the heart and skeletal muscle. This protein regulates Myotonic Dystrophy Protein Kinase, which plays an important role in maintenance of muscle structure and function. [provided by RefSeq, Dec 2012]'