CD247 (NM_198053) Human Mass Spec Standard

CAT#: PH314725

CD247 MS Standard C13 and N15-labeled recombinant protein (NP_932170)

Product Images

Coomassie blue staining of purified CD247 protein (Cat# TP314725). The protein was produced from HEK293T cells transfected with CD247 cDNA clone (Cat# RC214725) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC214725
• Predicted MW: 16.3 kDa
• Protein Sequence:
  Sequence Link

  >RC214725 representing NM_198053
  Red=Cloning site Green=Tags(s)
  
  MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQ
  LYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGL
  YQGLSTATKDTYDALHMQALPPR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_932170
• RefSeq Size: 1677
• RefSeq ORF: 1256
• Synonyms: CD3-ZETA; CD3H; CD3Q; CD3Z; IMD25; T3Z; TCRZ
• Locus ID: 919
• UniProt ID: P20963
• Cytogenetics: 1q24.2
• Summary: 'The protein encoded by this gene is T-cell receptor zeta, which together with T-cell receptor alpha/beta and gamma/delta heterodimers, and with CD3-gamma, -delta and -epsilon, forms the T-cell receptor-CD3 complex. The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the antigen results in impaired immune response. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Natural killer cell mediated cytotoxicity, T cell receptor signaling pathway