CD247 (NM_198053) Human Mass Spec Standard
CAT#: PH314725
CD247 MS Standard C13 and N15-labeled recombinant protein (NP_932170)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC214725 |
Predicted MW | 16.3 kDa |
Protein Sequence |
>RC214725 representing NM_198053
Red=Cloning site Green=Tags(s) MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQ LYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGL YQGLSTATKDTYDALHMQALPPR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_932170 |
RefSeq Size | 1677 |
RefSeq ORF | 1256 |
Synonyms | CD3-ZETA; CD3H; CD3Q; CD3Z; IMD25; T3Z; TCRZ |
Locus ID | 919 |
UniProt ID | P20963 |
Cytogenetics | 1q24.2 |
Summary | 'The protein encoded by this gene is T-cell receptor zeta, which together with T-cell receptor alpha/beta and gamma/delta heterodimers, and with CD3-gamma, -delta and -epsilon, forms the T-cell receptor-CD3 complex. The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the antigen results in impaired immune response. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Natural killer cell mediated cytotoxicity, T cell receptor signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403667 | CD247 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC424538 | CD247 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY403667 | Transient overexpression lysate of CD247 molecule (CD247), transcript variant 1 |
USD 325.00 |
|
LY424538 | Transient overexpression lysate of CD247 molecule (CD247), transcript variant 2 |
USD 325.00 |
|
PH306562 | CD247 MS Standard C13 and N15-labeled recombinant protein (NP_000725) |
USD 2,055.00 |
|
TP306562 | Recombinant protein of human CD247 molecule (CD247), transcript variant 2 |
USD 823.00 |
|
TP314725 | Recombinant protein of human CD247 molecule (CD247), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review