CABYR (NM_012189) Human Mass Spec Standard
CAT#: PH314772
CABYR MS Standard C13 and N15-labeled recombinant protein (NP_036321)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC214772 |
Predicted MW | 52.6 kDa |
Protein Sequence |
>RC214772 representing NM_012189
Red=Cloning site Green=Tags(s) MISSKPRLVVPYGLKTLLEGISRAVLKTNPSNINQFAAAYFQELTMYRGNTTMDIKDLVKQFHQIKVEKW SEGTTPQKKLECLKEPGKTSVESKVPTQMEKSTDTDEDNVTRTEYSDKTTQFPSVYAVPGTEQTEAVGGL SSKPATPKTTTPPSSPPPTAVSPEFAYVPADPAQLAAQMLGKVSSIHSDQSDVLMVDVATSMPVVIKEVP SSEAAEDVMVAAPLVCSGKVLEVQVVNQTSVHVDLGSQPKENEAEPSTASSVPLQDEQEPPAYDQAPEVT LQADIEVMSTVHISSVYNDVPVTEGVVYIEQLPEQIVIPFTDQVACLKENEQSKENEQSPRVSPKSVVEK TTSGMSKKSVESVKLAQLEENAKYSSVYMEAEATALLSDTSLKGQPEVPAQLLDAEGAIKIGSEKSLHLE VEITSIVSDNTGQEESGENSVPQEMEGKPVLSGEAAEAVHSGTSVKSSSGPFPPAPEGLTAPEIEPEGES TAE myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_036321 |
RefSeq Size | 2333 |
RefSeq ORF | 1479 |
Synonyms | CABYRa; CABYRc; CABYRc/d; CABYRe; CBP86; CT88; FSP-2; FSP2 |
Locus ID | 26256 |
UniProt ID | O75952, A0A024RC21 |
Cytogenetics | 18q11.2 |
Summary | To reach fertilization competence, spermatozoa undergo a series of morphological and molecular maturational processes, termed capacitation, involving protein tyrosine phosphorylation and increased intracellular calcium. The protein encoded by this gene localizes to the principal piece of the sperm flagellum in association with the fibrous sheath and exhibits calcium-binding when phosphorylated during capacitation. A pseudogene on chromosome 3 has been identified for this gene. Alternatively spliced transcript variants encoding distinct protein isoforms have been found for this gene. [provided by RefSeq, Jul 2013] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406955 | CABYR HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC406956 | CABYR HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC406957 | CABYR HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC408542 | CABYR HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC408543 | CABYR HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC415918 | CABYR HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC430062 | CABYR HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC430295 | CABYR HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC430296 | CABYR HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY406955 | Transient overexpression lysate of calcium binding tyrosine-(Y)-phosphorylation regulated (CABYR), transcript variant 2 |
USD 495.00 |
|
LY406956 | Transient overexpression lysate of calcium binding tyrosine-(Y)-phosphorylation regulated (CABYR), transcript variant 7 |
USD 325.00 |
|
LY406957 | Transient overexpression lysate of calcium binding tyrosine-(Y)-phosphorylation regulated (CABYR), transcript variant 6 |
USD 325.00 |
|
LY408542 | Transient overexpression lysate of calcium binding tyrosine-(Y)-phosphorylation regulated (CABYR), transcript variant 5 |
USD 325.00 |
|
LY408543 | Transient overexpression lysate of calcium binding tyrosine-(Y)-phosphorylation regulated (CABYR), transcript variant 3 |
USD 325.00 |
|
LY415918 | Transient overexpression lysate of calcium binding tyrosine-(Y)-phosphorylation regulated (CABYR), transcript variant 1 |
USD 495.00 |
|
LY430062 | Transient overexpression lysate of calcium binding tyrosine-(Y)-phosphorylation regulated (CABYR), transcript variant 3 |
USD 325.00 |
|
LY430295 | Transient overexpression lysate of calcium binding tyrosine-(Y)-phosphorylation regulated (CABYR), transcript variant 7 |
USD 325.00 |
|
LY430296 | Transient overexpression lysate of calcium binding tyrosine-(Y)-phosphorylation regulated (CABYR), transcript variant 6 |
USD 325.00 |
|
TP314772 | Recombinant protein of human calcium binding tyrosine-(Y)-phosphorylation regulated (CABYR), transcript variant 1 |
USD 788.00 |
{0} Product Review(s)
Be the first one to submit a review