VKORC1 (NM_206824) Human Mass Spec Standard

CAT#: PH314831

VKORC1 MS Standard C13 and N15-labeled recombinant protein (NP_996560)

Product Images

Coomassie blue staining of purified VKORC1 protein (Cat# TP314831). The protein was produced from HEK293T cells transfected with VKORC1 cDNA clone (Cat# RC214831) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC214831
• Predicted MW: 9.7 kDa
• Protein Sequence:
  Sequence Link

  >RC214831 representing NM_206824
  Red=Cloning site Green=Tags(s)
  
  MGSTWGSPGWVRLALCLTGLVLSLYALHVKAARARDRDYRALCDVGTAISCSRVFSSRLPADTLGLCPDA
  AELPGVSRWFCLPGLDPVLRAL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_996560
• RefSeq Size: 907
• RefSeq ORF: 276
• Synonyms: EDTP308; MST134; MST576; VKCFD2; VKOR
• Locus ID: 79001
• UniProt ID: Q9BQB6, A0A0S2Z5X7
• Cytogenetics: 16p11.2
• Summary: This gene encodes the catalytic subunit of the vitamin K epoxide reductase complex, which is responsible for the reduction of inactive vitamin K 2,3-epoxide to active vitamin K in the endoplasmic reticulum membrane. Vitamin K is a required co-factor for carboxylation of glutamic acid residues by vitamin K-dependent gamma-carboxylase in blood-clotting enzymes. Allelic variation in this gene is associated with vitamin k-dependent clotting factors combined deficiency of 2, and increased resistance or sensitivity to warfarin, an inhibitor of vitamin K epoxide reductase. Pseudogenes of this gene are located on chromosomes 1 and X. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2015]
• Protein Families: Transmembrane