EGFR (NM_201283) Human Mass Spec Standard
CAT#: PH314877
EGFR MS Standard C13 and N15-labeled recombinant protein (NP_958440)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC214877 |
| Predicted MW | 42.4 kDa |
| Protein Sequence |
>RC214877 representing NM_201283
Red=Cloning site Green=Tags(s) MRPSGTAGAALLALLAALCPASRALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEVVLGNLEITYV QRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYYENSYALAVLSNYDANKTGLKELPMRNL QEILHGAVRFSNNPALCNVESIQWRDIVSSDFLSNMSMDFQNHLGSCQKCDPSCPNGSCWGAGEENCQKL TKIICAQQCSGRCRGKSPSDCCHNQCAAGCTGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVN PEGKYSFGATCVKKCPRNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLS INATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGLS myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_958440 |
| RefSeq Size | 1595 |
| RefSeq ORF | 1215 |
| Synonyms | ERBB; ERBB1; HER1; mENA; NISBD2; PIG61 |
| Locus ID | 1956 |
| UniProt ID | P00533 |
| Cytogenetics | 7p11.2 |
| Summary | 'The protein encoded by this gene is a transmembrane glycoprotein that is a member of the protein kinase superfamily. This protein is a receptor for members of the epidermal growth factor family. EGFR is a cell surface protein that binds to epidermal growth factor, thus inducing receptor dimerization and tyrosine autophosphorylation leading to cell proliferation. Mutations in this gene are associated with lung cancer. EGFR is a component of the cytokine storm which contributes to a severe form of Coronavirus Disease 2019 (COVID-19) resulting from infection with severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2). [provided by RefSeq, Jul 2020]' |
| Protein Families | Adult stem cells, Cancer stem cells, Druggable Genome, ES Cell Differentiation/IPS, Protein Kinase, Secreted Protein, Stem cell relevant signaling - JAK/STAT signaling pathway, Transmembrane |
| Protein Pathways | Adherens junction, Bladder cancer, Calcium signaling pathway, Colorectal cancer, Cytokine-cytokine receptor interaction, Dorso-ventral axis formation, Endocytosis, Endometrial cancer, Epithelial cell signaling in Helicobacter pylori infection, ErbB signaling pathway, Focal adhesion, Gap junction, Glioma, GnRH signaling pathway, MAPK signaling pathway, Melanoma, Non-small cell lung cancer, Pancreatic cancer, Pathways in cancer, Prostate cancer, Regulation of actin cytoskeleton |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404514 | EGFR HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC404515 | EGFR HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC417434 | EGFR HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
| LY404514 | Transient overexpression lysate of epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian) (EGFR), transcript variant 2 |
USD 665.00 |
|
| LY404515 | Transient overexpression lysate of epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian) (EGFR), transcript variant 3 |
USD 436.00 |
|
| LY417434 | Transient overexpression lysate of epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian) (EGFR), transcript variant 1 |
USD 665.00 |
|
| TP314877 | Recombinant protein of human epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian) (EGFR), transcript variant 3 |
USD 788.00 |
|
| TP700043 | Recombinant protein of human epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian) (EGFR),residues 25-645 aa, expressed in human cells |
USD 748.00 |
|
| TP700065 | Purified protein of Homo sapiens epidermal growth factor receptor (EGFR), transcript variant 1, mutant L858R, with C-terminal MYC/DDK tag, expressed in human cells, 20ug |
USD 748.00 |
|
| TP700080 | Purified protein of Homo sapiens epidermal growth factor receptor (EGFR), transcript variant 1, mutant K745_K750del, with C-terminal MYC/DDK tag, expressed in human cells, 20ug |
USD 748.00 |
|
| TP700103 | Purified recombinant protein of Human epidermal growth factor receptor (EGFR), transcript variant 3, with C-terminal DDK/His tag, expressed in human cells |
USD 748.00 |
|
| TP700204 | Purified recombinant protein of Homo sapiens epidermal growth factor receptor vIII (EGFR vIII) extracellular domain, residues Leu25-Ser378, with C-terminal DDK/His tag, expressed in HEK293 cells. |
USD 748.00 |
|
| TP710003 | Recombinant protein of human epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian) (EGFR),residues 1-645aa,expressed in sf9 cells |
USD 425.00 |
|
| TP710011 | Recombinant protein of human epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian) (EGFR), full length, with C-terminal DDK tag, expressed in sf9 cells |
USD 425.00 |
|
| TP710358 | Purified recombinant protein of Human epidermal growth factor receptor (EGFR), transcript variant 1, esidues 669-1210aa, with C-terminal DDK tag, expressed in sf9, 20ug |
USD 425.00 |
|
| TP723071 | Purified recombinant protein of Human epidermal growth factor receptor (EGFR), transcript variant 3. |
USD 240.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China