FTHL17 (NM_031894) Human Mass Spec Standard

CAT#: PH314888

FTHL17 MS Standard C13 and N15-labeled recombinant protein (NP_114100)

Product Images

Coomassie blue staining of purified FTHL17 protein (Cat# TP314888). The protein was produced from HEK293T cells transfected with FTHL17 cDNA clone (Cat# RC214888) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC214888
• Predicted MW: 21.1 kDa
• Protein Sequence:
  Sequence Link

  >RC214888 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MATAQPSQVRQKYDTNCDAAINSHITLELYTSYLYLSMAFYFNRDDVALENFFRYFLRLSDDKMEHAQKL
  MRLQNLRGGHICLHDIRKPECQGWESGLVAMESAFHLEKNVNQSLLDLYQLAVEKGDPQLCHFLESHYLH
  EQVKTIKELGGYVSNLRKICSPEAGLAEYLFDKLTLGGRVKET
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_114100
• RefSeq Size: 830
• RefSeq ORF: 549
• Synonyms: CT38
• Locus ID: 53940
• UniProt ID: Q9BXU8, A0A384NPV7
• Cytogenetics: Xp21.2
• Summary: This gene encodes a ferritin heavy chain-like protein. This gene is primarily expressed in embryonic germ cells. The encoded protein may lack ferroxidase activity. Multiple pseudogenes of this gene are found on chromosome X. [provided by RefSeq, Oct 2016]
• Protein Families: Transmembrane