C16orf72 (NM_014117) Human Mass Spec Standard

CAT#: PH314935

C16orf72 MS Standard C13 and N15-labeled recombinant protein (NP_054836)

Product Images

Coomassie blue staining of purified C16orf72 protein (Cat# TP314935). The protein was produced from HEK293T cells transfected with C16orf72 cDNA clone (Cat# RC214935) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC214935
• Predicted MW: 30.9 kDa
• Protein Sequence:
  Sequence Link

  >RC214935 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEERKEEGEAEIQEHGPEHWFSKWERQCLAEAEQDEQLPPELQEEAAAAAQPEHKQQKLWHLFQNSATAV
  AQLYKDRVCQQPGLSLWVPFQNAATAVTNLYKESVDTHQRSFDIGIQIGYQRRNKDVLAWVKKRRRTIRR
  EDLISFLCGKVPPPRNSRAPPRLTVVSPNRATSTETSSSVETDLQPFREAIALHGLSGAMASISVRSSTP
  GSPTHVSSGSNASRRRNGLHDVDLNTFISEEMALHLDNGGTRKRTSAQCGDVITDSPTHKRNRMI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_054836
• RefSeq Size: 3996
• RefSeq ORF: 825
• Synonyms: PRO0149
• Locus ID: 29035
• UniProt ID: Q14CZ0
• Cytogenetics: 16p13.2
• Summary: Belongs to the UPF0472 family. [UniProtKB/Swiss-Prot Function]