PPP1R11 (NM_021959) Human Mass Spec Standard

CAT#: PH314995

PPP1R11 MS Standard C13 and N15-labeled recombinant protein (NP_068778)

Product Images

Coomassie blue staining of purified PPP1R11 protein (Cat# TP314995). The protein was produced from HEK293T cells transfected with PPP1R11 cDNA clone (Cat# RC214995) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC214995
• Predicted MW: 13.8 kDa
• Protein Sequence:
  Sequence Link

  >RC214995 representing NM_021959
  Red=Cloning site Green=Tags(s)
  
  MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDNEHMGRRSSKCCCIYEKPRAF
  GESSTESDEEEEEGCGHTHCVRGHRKGRRRATLGPTPTTPPQPPDPSQPPPGPMQH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_068778
• RefSeq Size: 1620
• RefSeq ORF: 378
• Synonyms: CFAP255; HCG-V; HCGV; IPP3; TCTE5; TCTEX5
• Locus ID: 6992
• UniProt ID: O60927, A2BEK1
• Cytogenetics: 6p22.1
• Summary: 'This gene encodes a specific inhibitor of protein phosphatase-1 (PP1) with a differential sensitivity toward the metal-independent and metal-dependent forms of PP1. The gene is located within the major histocompatibility complex class I region on chromosome 6. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome