DNAJC12 (NM_201262) Human Mass Spec Standard

CAT#: PH315035

DNAJC12 MS Standard C13 and N15-labeled recombinant protein (NP_957714)

Product Images

Coomassie blue staining of purified DNAJC12 protein (Cat# TP315035). The protein was produced from HEK293T cells transfected with DNAJC12 cDNA clone (Cat# RC215035) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC215035
• Predicted MW: 12.3 kDa
• Protein Sequence:
  Sequence Link

  >RC215035 representing NM_201262
  Red=Cloning site Green=Tags(s)
  
  MDAILNYRSEDTEDYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPKAVETFQKLQKAKEILTNEE
  SRARYDHWRRSQMSMPFQQWEALNDSVKTVGFSLGAT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_957714
• RefSeq Size: 786
• RefSeq ORF: 321
• Synonyms: HPANBH4; JDP1
• Locus ID: 56521
• UniProt ID: Q9UKB3
• Cytogenetics: 10q21.3
• Summary: This gene encodes a member of a subclass of the HSP40/DnaJ protein family. Members of this family of proteins are associated with complex assembly, protein folding, and export. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]