C19orf63 (EMC10) (NM_175063) Human Mass Spec Standard

CAT#: PH315076

C19orf63 MS Standard C13 and N15-labeled recombinant protein (NP_778233)

Product Images

Coomassie blue staining of purified EMC10 protein (Cat# TP315076). The protein was produced from HEK293T cells transfected with EMC10 cDNA clone (Cat# RC215076) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC215076
• Predicted MW: 26.6 kDa
• Protein Sequence:
  Sequence Link

  >RC215076 representing NM_175063
  Red=Cloning site Green=Tags(s)
  
  MAAASAGATRLLLLLLMAVAAPSRARGSGCRAGTGARGAGAEGREGEACGTVGLLLEHSFEIDDSANFRK
  RGSLLWNQQDGTLSLSQRQLSEEERGRLRDVAALNGLYRVRIPRRPGALDGLEAGGYVSSFVPACSLVES
  HLSDQLTLHVDVAGNVVGVSVVTHPGGCRGHEVEDVDLELFNTSVQLQPPTTAPGPETAAFIERLEMEQA
  QKAKNPQEQKSFFAKYWHIILGGAVLLTALRPAAPGPAPPPQEA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_778233
• RefSeq Size: 2740
• RefSeq ORF: 762
• Synonyms: C19orf63; HSM1; HSS1
• Locus ID: 284361
• UniProt ID: Q5UCC4
• Cytogenetics: 19q13.33
• Protein Families: Transmembrane