Gastrin Releasing Peptide (GRP) (NM_001012513) Human Mass Spec Standard

CAT#: PH315122

GRP MS Standard C13 and N15-labeled recombinant protein (NP_001012531)

Product Images

Coomassie blue staining of purified GRP protein (Cat# TP315122). The protein was produced from HEK293T cells transfected with GRP cDNA clone (Cat# RC215122) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC215122
• Predicted MW: 15.18 kDa
• Protein Sequence:
  Sequence Link

  >RC215122 representing NM_001012513
  Red=Cloning site Green=Tags(s)
  
  MRGRELPLVLLALVLCLAPRGRAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKSTGESSSVSERGSLKQQ
  LREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDLVDSLLQVLNVKEGTPS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001012531
• RefSeq Size: 844
• RefSeq ORF: 414
• Synonyms: BN; GRP-10; preproGRP; proGRP
• Locus ID: 2922
• UniProt ID: P07492
• Cytogenetics: 18q21.32
• Summary: 'This gene encodes a member of the bombesin-like family of gastrin-releasing peptides. The encoded preproprotein is proteolytically processed to generate two peptides, gastrin-releasing peptide and neuromedin-C. These peptides regulate numerous functions of the gastrointestinal and central nervous systems, including release of gastrointestinal hormones, smooth muscle cell contraction, and epithelial cell proliferation. These peptides are also likely to play a role in human cancers of the lung, colon, stomach, pancreas, breast, and prostate. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed. [provided by RefSeq, Jan 2016]'
• Protein Families: Secreted Protein