Adenylate Kinase 1 (AK1) (NM_000476) Human Mass Spec Standard

CAT#: PH315130

AK1 MS Standard C13 and N15-labeled recombinant protein (NP_000467)

Product Images

Coomassie blue staining of purified AK1 protein (Cat# TP315130). The protein was produced from HEK293T cells transfected with AK1 cDNA clone (Cat# RC215130) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC215130
• Predicted MW: 21.5 kDa
• Protein Sequence:
  Sequence Link

  >RC215130 representing NM_000476
  Red=Cloning site Green=Tags(s)
  
  MEEKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLE
  TVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVD
  DNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000467
• RefSeq Size: 2271
• RefSeq ORF: 582
• Synonyms: HTL-S-58j
• Locus ID: 203
• UniProt ID: P00568, Q6FGX9
• Cytogenetics: 9q34.11
• Summary: 'This gene encodes an adenylate kinase enzyme involved in energy metabolism and homeostasis of cellular adenine nucleotide ratios in different intracellular compartments. This gene is highly expressed in skeletal muscle, brain and erythrocytes. Certain mutations in this gene resulting in a functionally inadequate enzyme are associated with a rare genetic disorder causing nonspherocytic hemolytic anemia. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2015]'
• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Purine metabolism