Amyloid Precursor Protein (APP) (NM_201414) Human Mass Spec Standard
CAT#: PH315147
APP MS Standard C13 and N15-labeled recombinant protein (NP_958817)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC215147 |
| Predicted MW | 76.9 kDa |
| Protein Sequence |
>RC215147 representing NM_201414
Red=Cloning site Green=Tags(s) MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGIL QYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQER MDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWW GGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTT ESVEEVVRVPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPK ADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLK KYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDEL LQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTEN EVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL MVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_958817 |
| RefSeq Size | 3416 |
| RefSeq ORF | 2085 |
| Synonyms | AAA; ABETA; ABPP; AD1; APPI; CTFgamma; CVAP; PN-II; PN2; preA4 |
| Locus ID | 351 |
| UniProt ID | P05067 |
| Cytogenetics | 21q21.3 |
| Summary | 'This gene encodes a cell surface receptor and transmembrane precursor protein that is cleaved by secretases to form a number of peptides. Some of these peptides are secreted and can bind to the acetyltransferase complex APBB1/TIP60 to promote transcriptional activation, while others form the protein basis of the amyloid plaques found in the brains of patients with Alzheimer disease. In addition, two of the peptides are antimicrobial peptides, having been shown to have bacteriocidal and antifungal activities. Mutations in this gene have been implicated in autosomal dominant Alzheimer disease and cerebroarterial amyloidosis (cerebral amyloid angiopathy). Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq, Aug 2014]' |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Alzheimer's disease |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404408 | APP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC404409 | APP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC424694 | APP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC427815 | APP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY404408 | Transient overexpression lysate of amyloid beta (A4) precursor protein (APP), transcript variant 2 |
USD 436.00 |
|
| LY404409 | Transient overexpression lysate of amyloid beta (A4) precursor protein (APP), transcript variant 3 |
USD 665.00 |
|
| LY424694 | Transient overexpression lysate of amyloid beta (A4) precursor protein (APP), transcript variant 1 |
USD 665.00 |
|
| LY427815 | Transient overexpression lysate of amyloid beta (A4) precursor protein (APP), transcript variant 5 |
USD 436.00 |
|
| PH309575 | APP MS Standard C13 and N15-labeled recombinant protein (NP_958816) |
USD 2,055.00 |
|
| TP309575 | Recombinant protein of human amyloid beta (A4) precursor protein (APP), transcript variant 2 |
USD 867.00 |
|
| TP315147 | Recombinant protein of human amyloid beta (A4) precursor protein (APP), transcript variant 3 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China