FAM151B (NM_205548) Human Mass Spec Standard

CAT#: PH315182

FAM151B MS Standard C13 and N15-labeled recombinant protein (NP_991111)

Product Images

Coomassie blue staining of purified FAM151B protein (Cat# TP315182). The protein was produced from HEK293T cells transfected with FAM151B cDNA clone (Cat# RC215182) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC215182
• Predicted MW: 31.4 kDa
• Protein Sequence:
  Sequence Link

  >RC215182 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAASAGGPGSWSENILEYFLRNSQITAEDGAEITWYHAANHKAQTNEALKSTAHMIEADVLLPSDGSEHS
  QPIMAHPPETNSDNTLQEWLTEVMKSNKGIKLDFKSLAVVEPSMMLLENVKRHLKRPVWINADILPGPNG
  NSKVIDAKPFLDTVISFFPDVTFSLGWTTGWHPEKVNEGYSWTMVKEMEYICNELSQPVTFPVRAALVRQ
  SCSQLLWLLKKSNRYSLTIWTGKNDNYSVEDLLYIRDHFDKKQVFYDILEPQNHEFKQAIGIKVNL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_991111
• RefSeq Size: 1707
• RefSeq ORF: 828
• Synonyms: UNQ9217
• Locus ID: 167555
• UniProt ID: Q6UXP7
• Cytogenetics: 5q14.1
• Summary: Belongs to the FAM151 family. [UniProtKB/Swiss-Prot Function]