ETS1 (NM_005238) Human Mass Spec Standard

CAT#: PH315203

ETS1 MS Standard C13 and N15-labeled recombinant protein (NP_005229)

Product Images

Coomassie blue staining of purified ETS1 protein (Cat# TP315203). The protein was produced from HEK293T cells transfected with ETS1 cDNA clone (Cat# RC215203) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC215203
• Predicted MW: 50.2 kDa
• Protein Sequence:
  Sequence Link

  >RC215203 representing NM_005238
  Red=Cloning site Green=Tags(s)
  
  MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPR
  QWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPY
  QVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVIL
  RDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRV
  PSYDSFDSEDYPAALPNHKPKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSC
  QSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQS
  LLGYTPEELHAMLDVKPDADE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005229
• RefSeq Size: 5228
• RefSeq ORF: 1323
• Synonyms: c-ets-1; ETS-1; EWSR2; p54
• Locus ID: 2113
• UniProt ID: P14921, B4DW78
• Cytogenetics: 11q24.3
• Summary: 'This gene encodes a member of the ETS family of transcription factors, which are defined by the presence of a conserved ETS DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T in target genes. These proteins function either as transcriptional activators or repressors of numerous genes, and are involved in stem cell development, cell senescence and death, and tumorigenesis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.[provided by RefSeq, Jul 2011]'
• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Dorso-ventral axis formation, Pathways in cancer, Renal cell carcinoma