Bcl G (BCL2L14) (NM_138723) Human Mass Spec Standard
CAT#: PH315213
BCL2L14 MS Standard C13 and N15-labeled recombinant protein (NP_620049)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215213 |
Predicted MW | 36.6 kDa |
Protein Sequence |
>RC215213 protein sequence
Red=Cloning site Green=Tags(s) MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRTRSLSQRGLGNCSANESWTEV SWPCRNSQSSEKAINLGKKKSSWKAFFGVVEKEDSQSTPAKVSAQGQRTLEYQDSHSQQWSRCLSNVEQC LEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILA KIVELLKYSGDQLERKLKKDKALMGHFQDGLSYSVFKTITDQVLMGVDPRGESEVKAQGFKAALVIDVTA KLTAIDNHPMNRVLGFGTKYLKENFSPWIQQHGGWEKILGISHEEVD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_620049 |
RefSeq Size | 1930 |
RefSeq ORF | 981 |
Synonyms | BCLG |
Locus ID | 79370 |
UniProt ID | Q9BZR8, A0A024RAR1 |
Cytogenetics | 12p13.2 |
Summary | The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. Overexpression of this gene has been shown to induce apoptosis in cells. Three alternatively spliced transcript variants encoding two distinct isoforms have been reported for this gene. [provided by RefSeq, May 2009] |
Protein Families | Druggable Genome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408531 | BCL2L14 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC408532 | BCL2L14 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC408533 | BCL2L14 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC410728 | BCL2L14 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC429763 | BCL2L14 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430065 | BCL2L14 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY408531 | Transient overexpression lysate of BCL2-like 14 (apoptosis facilitator) (BCL2L14), transcript variant 1 |
USD 396.00 |
|
LY408532 | Transient overexpression lysate of BCL2-like 14 (apoptosis facilitator) (BCL2L14), transcript variant 4 |
USD 396.00 |
|
LY408533 | Transient overexpression lysate of BCL2-like 14 (apoptosis facilitator) (BCL2L14), transcript variant 3 |
USD 396.00 |
|
LY410728 | Transient overexpression lysate of BCL2-like 14 (apoptosis facilitator) (BCL2L14), transcript variant 2 |
USD 396.00 |
|
LY429763 | Transient overexpression lysate of BCL2-like 14 (apoptosis facilitator) (BCL2L14), transcript variant 2 |
USD 396.00 |
|
LY430065 | Transient overexpression lysate of BCL2-like 14 (apoptosis facilitator) (BCL2L14), transcript variant 4 |
USD 396.00 |
|
PH306404 | BCL2L14 MS Standard C13 and N15-labeled recombinant protein (NP_620048) |
USD 2,055.00 |
|
TP306404 | Recombinant protein of human BCL2-like 14 (apoptosis facilitator) (BCL2L14), transcript variant 1 |
USD 823.00 |
|
TP315213 | Recombinant protein of human BCL2-like 14 (apoptosis facilitator) (BCL2L14), transcript variant 4 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review