IL21 (NM_021803) Human Mass Spec Standard

CAT#: PH315235

IL21 MS Standard C13 and N15-labeled recombinant protein (NP_068575)

Product Images

Coomassie blue staining of purified IL21 protein (Cat# TP315235). The protein was produced from HEK293T cells transfected with IL21 cDNA clone (Cat# RC215235) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC215235
• Predicted MW: 18.5 kDa
• Protein Sequence:
  Sequence Link

  >RC215235 representing NM_021803
  Red=Cloning site Green=Tags(s)
  
  MRSSPGNMERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETN
  CEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERF
  KSLLQKMIHQHLSSRTHGSEDS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_068575
• RefSeq Size: 642
• RefSeq ORF: 486
• Synonyms: CVID11; IL-21; Za11
• Locus ID: 59067
• UniProt ID: Q9HBE4, A0A224B028
• Cytogenetics: 4q27
• Summary: This gene encodes a member of the common-gamma chain family of cytokines with immunoregulatory activity. The encoded protein plays a role in both the innate and adaptive immune responses by inducing the differentiation, proliferation and activity of multiple target cells including macrophages, natural killer cells, B cells and cytotoxic T cells. Dysregulation of this gene plays a role in multiple immune-mediated diseases including lupus, psoriasis and chronic inflammatory diseases. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011]
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway