IL21 (NM_021803) Human Recombinant Protein

CAT#: TP723217

Purified recombinant protein of Human interleukin 21 (IL21), transcript variant 1.

Product Images

Specifications

Product Data

• Species: Human
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  MQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
• Tag: Tag Free
• Predicted MW: 15.4 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Assay #1:Determined by its ability to proliferate activated B cells. Assay #2:Determined by its ability to induce human CD40L-activated naïve B cells to undergo Ig isotype switching to IgG, using an IL-21 concentration of 50 ng/ml. Maximal activity was achieved after approximately five cell divisions. _{Avery, D.T. et. al. (2008) J. Immunol. 181, 1767-1779.}
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_068575
• Locus ID: 59067
• UniProt ID: Q9HBE4, A0A224B028
• Cytogenetics: 4q27
• Refseq Size: 642
• Refseq ORF: 486
• Synonyms: CVID11; IL-21; Za11
• Summary: This gene encodes a member of the common-gamma chain family of cytokines with immunoregulatory activity. The encoded protein plays a role in both the innate and adaptive immune responses by inducing the differentiation, proliferation and activity of multiple target cells including macrophages, natural killer cells, B cells and cytotoxic T cells. Dysregulation of this gene plays a role in multiple immune-mediated diseases including lupus, psoriasis and chronic inflammatory diseases. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011]
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway