ARFGAP1 (NM_018209) Human Mass Spec Standard
CAT#: PH315268
ARFGAP1 MS Standard C13 and N15-labeled recombinant protein (NP_060679)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC215268 |
| Predicted MW | 44.5 kDa |
| Protein Sequence |
>RC215268 representing NM_018209
Red=Cloning site Green=Tags(s) MASPRTRKVLKEVRVQDENNVCFECGAFNPQWVSVTYGIWICLECSGRHRGLGVHLSFVRSVTMDKWKDI ELEKMKAGGNAKFREFLESQEDYDPCWSLQEKYNSRAAALFRDKVVALAEGREWSLESSPAQNWTPPQPR TLPSMVHRVSGQPQSVTASSDKAFEDWLNDDLGSYQGAQGNRYVGFGNTPPPQKKEDDFLNNAMSSLYSG WSSFTTGASRFASAAKEGATKFGSQASQKASELGHSLNENVLKPAQEKVKEGKIFDDVSSGVSQLASKVQ GVGSKGWRDVTTFFSGKAEGPLDSPSEGHSYQNSGLDHFQNSNIDQSFWETFGSAEPTKTRKSPSSDSWT CADTSTERRSSDSWEVWGSASTNRNSNSDGGEGGEGTKKAVPPAVPTDDGWDNQNW myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_060679 |
| RefSeq Size | 3250 |
| RefSeq ORF | 1218 |
| Synonyms | ARF1GAP; HRIHFB2281 |
| Locus ID | 55738 |
| UniProt ID | Q8N6T3, Q53F62 |
| Cytogenetics | 20q13.33 |
| Summary | The protein encoded by this gene is a GTPase-activating protein, which associates with the Golgi apparatus and which interacts with ADP-ribosylation factor 1. The encoded protein promotes hydrolysis of ADP-ribosylation factor 1-bound GTP and is required for the dissociation of coat proteins from Golgi-derived membranes and vesicles. Dissociation of the coat proteins is required for the fusion of these vesicles with target compartments. The activity of this protein is stimulated by phosphoinosides and inhibited by phosphatidylcholine. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013] |
| Protein Pathways | Endocytosis |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406240 | ARFGAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC413218 | ARFGAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY406240 | Transient overexpression lysate of ADP-ribosylation factor GTPase activating protein 1 (ARFGAP1), transcript variant 2 |
USD 436.00 |
|
| LY413218 | Transient overexpression lysate of ADP-ribosylation factor GTPase activating protein 1 (ARFGAP1), transcript variant 1 |
USD 436.00 |
|
| PH306987 | ARFGAP1 MS Standard C13 and N15-labeled recombinant protein (NP_783202) |
USD 2,055.00 |
|
| TP306987 | Recombinant protein of human ADP-ribosylation factor GTPase activating protein 1 (ARFGAP1), transcript variant 2 |
USD 823.00 |
|
| TP315268 | Recombinant protein of human ADP-ribosylation factor GTPase activating protein 1 (ARFGAP1), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China