B7H3 (CD276) (NM_025240) Human Mass Spec Standard
CAT#: PH315291
CD276 MS Standard C13 and N15-labeled recombinant protein (NP_079516)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215291 |
Predicted MW | 33.6 kDa |
Protein Sequence |
>RC215291 representing NM_025240
Red=Cloning site Green=Tags(s) MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLT DTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAA PYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRV VLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWRKIKQSCEE ENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_079516 |
RefSeq Size | 2765 |
RefSeq ORF | 948 |
Synonyms | 4Ig-B7-H3; B7-H3; B7H3; B7RP-2 |
Locus ID | 80381 |
UniProt ID | Q5ZPR3 |
Cytogenetics | 15q24.1 |
Summary | The protein encoded by this gene belongs to the immunoglobulin superfamily, and thought to participate in the regulation of T-cell-mediated immune response. Studies show that while the transcript of this gene is ubiquitously expressed in normal tissues and solid tumors, the protein is preferentially expressed only in tumor tissues. Additionally, it was observed that the 3' UTR of this transcript contains a target site for miR29 microRNA, and there is an inverse correlation between the expression of this protein and miR29 levels, suggesting regulation of expression of this gene product by miR29. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Cell adhesion molecules (CAMs) |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410803 | CD276 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC422539 | CD276 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC425464 | CD276 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY410803 | Transient overexpression lysate of CD276 molecule (CD276), transcript variant 2 |
USD 325.00 |
|
LY422539 | Transient overexpression lysate of CD276 molecule (CD276), transcript variant 1 |
USD 495.00 |
|
LY425464 | Transient overexpression lysate of CD276 molecule (CD276), transcript variant 1 |
USD 325.00 |
|
TP315291 | Recombinant protein of human CD276 molecule (CD276), transcript variant 2 |
USD 788.00 |
|
TP700270 | Purified recombinant protein of human CD276 molecule (CD276), transcript variant 1, with C-terminal DDK/His tag, expressed in human cells, 20 µg |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review