nkx6.3 (NKX6-3) (NM_152568) Human Mass Spec Standard

CAT#: PH315354

NKX6 MS Standard C13 and N15-labeled recombinant protein (NP_689781)

Product Images

Coomassie blue staining of purified NKX6-3 protein (Cat# TP315354). The protein was produced from HEK293T cells transfected with NKX6-3 cDNA clone (Cat# RC215354) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC215354
• Predicted MW: 14.1 kDa
• Protein Sequence:
  Sequence Link

  >RC215354 representing NM_152568
  Red=Cloning site Green=Tags(s)
  
  MQQGQLAPGSRLCSGPWGLPELQPAAPSSSAAQLPWGESWGEEADTPACLSASGVWFQNRRTKWRKKSAL
  EPSSSTPRAPGGAGAGAGGDRAPSENEDDEYNKPLDPDSDDEKIRLLLRKHRAAFSVLSLGAHSV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_689781
• RefSeq Size: 1640
• RefSeq ORF: 405
• Synonyms: NKX6.3
• Locus ID: 157848
• UniProt ID: A6NJ46
• Cytogenetics: 8p11.21
• Summary: The NKX family of homeodomain proteins controls numerous developmental processes. Members of the NKX6 subfamily, including NKX6-3, are involved in development of the central nervous system (CNS), gastrointestinal tract, and pancreas (Alanentalo et al., 2006 [PubMed 16326147]). [supplied by OMIM, Mar 2008]