Protein cornichon homolog 2 (CNIH2) (NM_182553) Human Mass Spec Standard

CAT#: PH315357

CNIH2 MS Standard C13 and N15-labeled recombinant protein (NP_872359)

Product Images

Coomassie blue staining of purified CNIH2 protein (Cat# TP315357). The protein was produced from HEK293T cells transfected with CNIH2 cDNA clone (Cat# RC215357) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC215357
• Predicted MW: 18.8 kDa
• Protein Sequence:
  Sequence Link

  >RC215357 representing NM_182553
  Red=Cloning site Green=Tags(s)
  
  MAFTFAAFCYMLTLVLCASLIFFVIWHIIAFDELRTDFKNPIDQGNPARARERLKNIERICCLLRKLVVP
  EYSIHGLFCLMFLCAAEWVTLGLNIPLLFYHLWRYFHRPADGSEVMYDAVSIMNADILNYCQKESWCKLA
  FYLLSFFYYLYSMVYTLVSF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_872359
• RefSeq Size: 1399
• RefSeq ORF: 480
• Synonyms: CNIH-2; Cnil
• Locus ID: 254263
• UniProt ID: Q6PI25
• Cytogenetics: 11q13.2
• Summary: The protein encoded by this gene is an auxiliary subunit of the ionotropic glutamate receptor of the AMPA subtype. AMPA receptors mediate fast synaptic neurotransmission in the central nervous system. This protein has been reported to interact with the Type I AMPA receptor regulatory protein isoform gamma-8 to control assembly of hippocampal AMPA receptor complexes, thereby modulating receptor gating and pharmacology. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]
• Protein Families: Transmembrane