Livin (BIRC7) (NM_022161) Human Mass Spec Standard
CAT#: PH315363
BIRC7 MS Standard C13 and N15-labeled recombinant protein (NP_071444)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215363 |
Predicted MW | 30.7 kDa |
Protein Sequence |
>RC215363 representing NM_022161
Red=Cloning site Green=Tags(s) MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEEEEG AGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDP WTEHAKWFPSCQFLLRSKGRDFVHSVQETHSQLLGSWDPWEEPEDAAPVAPSVPASGYPELPTPRREVQS ESAQEPGARDVEAQLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFLS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_071444 |
RefSeq Size | 1268 |
RefSeq ORF | 840 |
Synonyms | KIAP; LIVIN; ML-IAP; MLIAP; RNF50 |
Locus ID | 79444 |
UniProt ID | Q96CA5 |
Cytogenetics | 20q13.33 |
Summary | This gene encodes a member of the inhibitor of apoptosis protein (IAP) family, and contains a single copy of a baculovirus IAP repeat (BIR) as well as a RING-type zinc finger domain. The BIR domain is essential for inhibitory activity and interacts with caspases, while the RING finger domain sometimes enhances antiapoptotic activity but does not inhibit apoptosis alone. Elevated levels of the encoded protein may be associated with cancer progression and play a role in chemotherapy sensitivity. Alternative splicing results in multiple transcript variants [provided by RefSeq, Jul 2013] |
Protein Families | Druggable Genome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403386 | BIRC7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC411731 | BIRC7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY403386 | Transient overexpression lysate of baculoviral IAP repeat-containing 7 (BIRC7), transcript variant 1 |
USD 325.00 |
|
LY411731 | Transient overexpression lysate of baculoviral IAP repeat-containing 7 (BIRC7), transcript variant 2 |
USD 325.00 |
|
PH304906 | BIRC7 MS Standard C13 and N15-labeled recombinant protein (NP_647478) |
USD 2,055.00 |
|
TP304906 | Recombinant protein of human baculoviral IAP repeat-containing 7 (BIRC7), transcript variant 1 |
USD 823.00 |
|
TP315363 | Recombinant protein of human baculoviral IAP repeat-containing 7 (BIRC7), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review