Syntenin (SDCBP) (NM_001007068) Human Mass Spec Standard
CAT#: PH315442
SDCBP MS Standard C13 and N15-labeled recombinant protein (NP_001007069)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC215442 |
| Predicted MW | 31.6 kDa |
| Protein Sequence |
>RC215442 representing NM_001007068
Red=Cloning site Green=Tags(s) MSLYPSLEDLKAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGA PLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSP ASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNG KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSI MKSLMDHTIPEV myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_001007069 |
| RefSeq Size | 2155 |
| RefSeq ORF | 876 |
| Synonyms | MDA-9; MDA9; ST1; SYCL; TACIP18 |
| Locus ID | 6386 |
| UniProt ID | O00560 |
| Cytogenetics | 8q12.1 |
| Summary | 'The protein encoded by this gene was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. The syntenin protein contains tandemly repeated PDZ domains that bind the cytoplasmic, C-terminal domains of a variety of transmembrane proteins. This protein may also affect cytoskeletal-membrane organization, cell adhesion, protein trafficking, and the activation of transcription factors. The protein is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus. Alternative splicing results in multiple transcript variants encoding different isoforms. Related pseudogenes have been identified on multiple chromosomes. [provided by RefSeq, Jan 2017]' |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417182 | SDCBP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC423571 | SDCBP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC423572 | SDCBP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC425198 | SDCBP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC425199 | SDCBP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY417182 | Transient overexpression lysate of syndecan binding protein (syntenin) (SDCBP), transcript variant 1 |
USD 436.00 |
|
| LY423571 | Transient overexpression lysate of syndecan binding protein (syntenin) (SDCBP), transcript variant 2 |
USD 436.00 |
|
| LY423572 | Transient overexpression lysate of syndecan binding protein (syntenin) (SDCBP), transcript variant 3 |
USD 436.00 |
|
| LY425198 | Transient overexpression lysate of syndecan binding protein (syntenin) (SDCBP), transcript variant 2 |
USD 396.00 |
|
| LY425199 | Transient overexpression lysate of syndecan binding protein (syntenin) (SDCBP), transcript variant 3 |
USD 396.00 |
|
| PH312681 | SDCBP MS Standard C13 and N15-labeled recombinant protein (NP_001007068) |
USD 2,055.00 |
|
| PH315390 | SDCBP MS Standard C13 and N15-labeled recombinant protein (NP_005616) |
USD 2,055.00 |
|
| TP312681 | Purified recombinant protein of Homo sapiens syndecan binding protein (syntenin) (SDCBP), transcript variant 2 |
USD 748.00 |
|
| TP315390 | Recombinant protein of human syndecan binding protein (syntenin) (SDCBP), transcript variant 1 |
USD 748.00 |
|
| TP315442 | Purified recombinant protein of Homo sapiens syndecan binding protein (syntenin) (SDCBP), transcript variant 3 |
USD 748.00 |
|
| TP720983 | Purified recombinant protein of Human syndecan binding protein (syntenin) (SDCBP), transcript variant 5 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China