Dystrophin (DMD) (NM_004018) Human Mass Spec Standard
CAT#: PH315529
DMD MS Standard C13 and N15-labeled recombinant protein (NP_004009)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC215529 |
| Predicted MW | 70.6 kDa |
| Protein Sequence |
>RC215529 representing NM_004018
Red=Cloning site Green=Tags(s) MREQLKGHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSAACDALDQHNL KQNDQPMDILQIINCLTTIYDRLEQEHNNLVNVPLCVDMCLNWLLNVYDTGRTGRIRVLSFKTGIISLCK AHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFANNKPEIEA ALFLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAK GHKMHYPMVEYCTPTTSGEDVRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTVLEGDNMETPASSPQLSHD DTHSRIEHYASRLAEMENSNGSYLNDSISPNESIDDEHLLIQHYCQSLNQDSPLSQPRSPAQILISLESE ERGELERILADLEEENRNLQAEYDRLKQQHEHKGLSPLPSPPEMMPTSPQSPRDAELIAEAKLLRQHKGR LEARMQILEDHNKQLESQLHRLRQLLEQPQAEAKVNGTTVSSPSTSLQRSDSSQPMLLRVVGSQTSDSMG EEDLLSPPQDTSTGLEEVMEQLNNSFPSSRGHNVGSLFHMADDLGRAMESLVSVMTDEEGAE myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_004009 |
| RefSeq Size | 4552 |
| RefSeq ORF | 1866 |
| Synonyms | BMD; CMD3B; DXS142; DXS164; DXS206; DXS230; DXS239; DXS268; DXS269; DXS270; DXS272; MRX85 |
| Locus ID | 1756 |
| UniProt ID | P11532 |
| Cytogenetics | Xp21.2-p21.1 |
| Summary | 'This gene spans a genomic range of greater than 2 Mb and encodes a large protein containing an N-terminal actin-binding domain and multiple spectrin repeats. The encoded protein forms a component of the dystrophin-glycoprotein complex (DGC), which bridges the inner cytoskeleton and the extracellular matrix. Deletions, duplications, and point mutations at this gene locus may cause Duchenne muscular dystrophy (DMD), Becker muscular dystrophy (BMD), or cardiomyopathy. Alternative promoter usage and alternative splicing result in numerous distinct transcript variants and protein isoforms for this gene. [provided by RefSeq, Dec 2016]' |
| Protein Pathways | Arrhythmogenic right ventricular cardiomyopathy (ARVC), Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM), Viral myocarditis |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418275 | DMD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC418276 | DMD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC418277 | DMD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC418278 | DMD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC418279 | DMD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC418281 | DMD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LY418275 | Transient overexpression lysate of dystrophin (DMD), transcript variant Dp71 |
USD 665.00 |
|
| LY418276 | Transient overexpression lysate of dystrophin (DMD), transcript variant Dp71b |
USD 665.00 |
|
| LY418277 | Transient overexpression lysate of dystrophin (DMD), transcript variant Dp71a |
USD 665.00 |
|
| LY418278 | Transient overexpression lysate of dystrophin (DMD), transcript variant Dp71ab |
USD 665.00 |
|
| LY418279 | Transient overexpression lysate of dystrophin (DMD), transcript variant Dp40 |
USD 436.00 |
|
| LY418281 | Transient overexpression lysate of dystrophin (DMD), transcript variant Dp140b |
USD 605.00 |
|
| PH313926 | DMD MS Standard C13 and N15-labeled recombinant protein (NP_004012) |
USD 2,055.00 |
|
| TP313926 | Recombinant protein of human dystrophin (DMD), transcript variant Dp140b |
USD 867.00 |
|
| TP315529 | Recombinant protein of human dystrophin (DMD), transcript variant Dp71ab |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China