C18orf1 (LDLRAD4) (NM_181483) Human Mass Spec Standard

CAT#: PH315558

C18orf1 MS Standard C13 and N15-labeled recombinant protein (NP_852148)

Product Images

Coomassie blue staining of purified LDLRAD4 protein (Cat# TP315558). The protein was produced from HEK293T cells transfected with LDLRAD4 cDNA clone (Cat# RC215558) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC215558
• Predicted MW: 25.6 kDa
• Protein Sequence:
  Sequence Link

  >RC215558 representing NM_181483
  Red=Cloning site Green=Tags(s)
  
  MAAELEFAQIIIIVVVVTVMVVVIVCLLNHYKVSTRSFINRPNQSRRREDGLPQIMHAPRSRDRFTAPSF
  IQRDRFSRFQPTYPYVQHEIDLPPTISLSDGEEPPPYQGPCTLQLRDPEQQMELNRESVRAPPNRTIFDS
  DLIDIAMYSGGPCPPSSNSGISASTCSSNGRMEGPPPTYSEVMGHHPGASFLHHQRSNAHRGSRLQFQQN
  NAESTIVPIKGKDRKPGNLV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_852148
• RefSeq Size: 8031
• RefSeq ORF: 690
• Synonyms: C18orf1
• Locus ID: 753
• Cytogenetics: 18p11.21
• Summary: ''
• Protein Families: Druggable Genome, Transmembrane