MACROD2 (NM_001033087) Human Mass Spec Standard
CAT#: PH315636
MACROD2 MS Standard C13 and N15-labeled recombinant protein (NP_001028259)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC215636 |
| Predicted MW | 23.6 kDa |
| Protein Sequence |
>RC215636 protein sequence
Red=Cloning site Green=Tags(s) MNEFFSVDDNNEEEEDVEMKEDSDENGPEEKQSVEEMEEQSQDADGVNTVTVPGPASEEAVEDCKDEDFA KDENITKGGEVTDHSVRDQDHPDGQENDSTKNEIKIETESQSSYMETEELSSNQEDAVIVEQPEVIPLTE DQEEKEGEKAPGEDTPRMPGKSEGSSDLENTPGPDVEMNSQVDKVNDPTESQQEDQLIAGAQDEAKEQRN GTK myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_001028259 |
| RefSeq Size | 4425 |
| RefSeq ORF | 639 |
| Synonyms | C2orf133; C20orf133 |
| Locus ID | 140733 |
| UniProt ID | A1Z1Q3 |
| Cytogenetics | 20p12.1 |
| Summary | The protein encoded by this gene is a deacetylase involved in removing ADP-ribose from mono-ADP-ribosylated proteins. The encoded protein has been shown to translocate from the nucleus to the cytoplasm upon DNA damage. [provided by RefSeq, May 2017] |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409100 | MACROD2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC429950 | MACROD2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY409100 | Transient overexpression lysate of MACRO domain containing 2 (MACROD2), transcript variant 1 |
USD 665.00 |
|
| LY429950 | Transient overexpression lysate of MACRO domain containing 2 (MACROD2), transcript variant 1 |
USD 396.00 |
|
| PH322689 | MACROD2 MS Standard C13 and N15-labeled recombinant protein (NP_542407) |
USD 2,055.00 |
|
| TP315636 | Recombinant protein of human MACRO domain containing 2 (MACROD2), transcript variant 2 |
USD 788.00 |
|
| TP322689 | Purified recombinant protein of Homo sapiens MACRO domain containing 2 (MACROD2), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China