Reticulon 1 (RTN1) (NM_206852) Human Mass Spec Standard

CAT#: PH315669

RTN1 MS Standard C13 and N15-labeled recombinant protein (NP_996734)

Product Images

Coomassie blue staining of purified RTN1 protein (Cat# TP315669). The protein was produced from HEK293T cells transfected with RTN1 cDNA clone (Cat# RC215669) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC215669
• Predicted MW: 23.4 kDa
• Protein Sequence:
  Sequence Link

  >RC215669 representing NM_206852
  Red=Cloning site Green=Tags(s)
  
  MQATADSTKMDCVWSNWKSQAIDLLYWRDIKQTGIVFGSFLLLLFSLTQFSVVSVVAYLALAALSATISF
  RIYKSVLQAVQKTDEGHPFKAYLELEITLSQEQIQKYTDCLQFYVNSTLKELRRLFLVQDLVDSLKFAVL
  MWLLTYVGALFNGLTLLLMAVVSMFTLPVVYVKHQAQIDQYLGLVRTHINAVVAKIQAKIPGAKRHAE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_996734
• RefSeq Size: 1710
• RefSeq ORF: 624
• Synonyms: NSP
• Locus ID: 6252
• UniProt ID: Q16799, A8K3B9
• Cytogenetics: 14q23.1
• Summary: 'This gene belongs to the family of reticulon encoding genes. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. This gene is considered to be a specific marker for neurological diseases and cancer, and is a potential molecular target for therapy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2011]'
• Protein Families: Transmembrane