PANK2 (NM_153638) Human Mass Spec Standard
CAT#: PH315676
PANK2 MS Standard C13 and N15-labeled recombinant protein (NP_705902)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC215676 |
| Predicted MW | 59.1 kDa |
| Protein Sequence |
>RC215676 representing NM_153638
Red=Cloning site Green=Tags(s) MRRLGPFHPRVHWAAPPSLSSGLHRLLFLRGTRIPSSTTLSPPRHDSLSLDGGTVNPPRVREPTGREAFG PSPASSDWLPARWRNGRGGRPRARLCSGWTAAEEARRNPTLGGLLGRQRLLLRMGGGRLGAPMERHGRAS ATSVSSAGEQAAGDPEGRRQEPLRRRASSASVPAVGASAEGTRRDRLGSYSGPTSVSRQRVESLRKKRPL FPWFGLDIGGTLVKLVYFEPKDITAEEEEEEVESLKSIRKYLTSNVAYGSTGIRDVHLELKDLTLCGRKG NLHFIRFPTHDMPAFIQMGRDKNFSSLHTVFCATGGGAYKFEQDFLTIGDLQLCKLDELDCLIKGILYID SVGFNGRSQCYYFENPADSEKCQKLPFDLKNPYPLLLVNIGSGVSILAVYSKDNYKRVTGTSLGGGTFFG LCCLLTGCTTFEEALEMASRGDSTKVDKLVRDIYGGDYERFGLPGWAVASSFGNMMSKEKREAVSKEDLA RATLITITNNIGSIARMCALNENINQVVFVGNFLRINTIAMRLLAYALDYWSKGQLKALFSEHEGYFGAV GALLELLKIP SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_705902 |
| RefSeq Size | 2280 |
| RefSeq ORF | 1710 |
| Synonyms | C20orf48; HARP; HSS; NBIA1; PKAN |
| Locus ID | 80025 |
| UniProt ID | Q9BZ23 |
| Cytogenetics | 20p13 |
| Summary | This gene encodes a protein belonging to the pantothenate kinase family and is the only member of that family to be expressed in mitochondria. Pantothenate kinase is a key regulatory enzyme in the biosynthesis of coenzyme A (CoA) in bacteria and mammalian cells. It catalyzes the first committed step in the universal biosynthetic pathway leading to CoA and is itself subject to regulation through feedback inhibition by acyl CoA species. Mutations in this gene are associated with HARP syndrome and pantothenate kinase-associated neurodegeneration (PKAN), formerly Hallervorden-Spatz syndrome. Alternative splicing, involving the use of alternate first exons, results in multiple transcripts encoding different isoforms. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Metabolic pathways, Pantothenate and CoA biosynthesis |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406998 | PANK2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC406999 | PANK2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC410958 | PANK2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC429747 | PANK2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC430279 | PANK2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY406998 | Transient overexpression lysate of pantothenate kinase 2 (PANK2), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 665.00 |
|
| LY406999 | Transient overexpression lysate of pantothenate kinase 2 (PANK2), transcript variant 2 |
USD 436.00 |
|
| LY410958 | Transient overexpression lysate of pantothenate kinase 2 (PANK2), transcript variant 3 |
USD 436.00 |
|
| LY429747 | Transient overexpression lysate of pantothenate kinase 2 (PANK2), transcript variant 3 |
USD 396.00 |
|
| LY430279 | Transient overexpression lysate of pantothenate kinase 2 (PANK2), transcript variant 2 |
USD 396.00 |
|
| TP315676 | Recombinant protein of human pantothenate kinase 2 (PANK2), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 788.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China