PAX8 (NM_013992) Human Mass Spec Standard

CAT#: PH315690

PAX8 MS Standard C13 and N15-labeled recombinant protein (NP_054698)

Product Images

Coomassie blue staining of purified PAX8 protein (Cat# TP315690). The protein was produced from HEK293T cells transfected with PAX8 cDNA clone (Cat# RC215690) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC215690
• Predicted MW: 30.9 kDa
• Protein Sequence:
  Sequence Link

  >RC215690 representing NM_013992
  Red=Cloning site Green=Tags(s)
  
  MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGS
  IRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPF
  NLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSI
  DSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQEVNTLAMPMATPPTPPTARPG
  ASPTPAC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_054698
• RefSeq Size: 3653
• RefSeq ORF: 861
• Synonyms: OTTHUMP00000158659; OTTHUMP00000158660; paired box 8; paired domain gene 8
• Locus ID: 7849
• UniProt ID: Q06710
• Cytogenetics: 2q14.1
• Summary: This gene encodes a member of the paired box (PAX) family of transcription factors. Members of this gene family typically encode proteins that contain a paired box domain, an octapeptide, and a paired-type homeodomain. This nuclear protein is involved in thyroid follicular cell development and expression of thyroid-specific genes. Mutations in this gene have been associated with thyroid dysgenesis, thyroid follicular carcinomas and atypical follicular thyroid adenomas. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Mar 2010]
• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Pathways in cancer, Thyroid cancer