PAX8 (NM_003466) Human Recombinant Protein
CAT#: TP300651
Recombinant protein of human paired box 8 (PAX8), transcript variant PAX8A
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200651 protein sequence
Red=Cloning site Green=Tags(s) MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGS IRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPF NLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSI DSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLTP SNTPLGRNLSTHQTYPVVADPHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPPFNAFPHAAS VYGQFTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEYSGNAYGHTPYSSYSEAWRFP NSSLLSSPYYYSSTSRPSAPPTTATAFDHL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 48 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003457 |
Locus ID | 7849 |
UniProt ID | Q06710, R9W7C9 |
Cytogenetics | 2q14.1 |
Refseq Size | 4065 |
Refseq ORF | 1350 |
Summary | This gene encodes a member of the paired box (PAX) family of transcription factors. Members of this gene family typically encode proteins that contain a paired box domain, an octapeptide, and a paired-type homeodomain. This nuclear protein is involved in thyroid follicular cell development and expression of thyroid-specific genes. Mutations in this gene have been associated with thyroid dysgenesis, thyroid follicular carcinomas and atypical follicular thyroid adenomas. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Mar 2010] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Pathways in cancer, Thyroid cancer |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401173 | PAX8 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC415550 | PAX8 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC415551 | PAX8 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC415574 | PAX8 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC429388 | PAX8 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC429402 | PAX8 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY401173 | Transient overexpression lysate of paired box 8 (PAX8), transcript variant PAX8A |
USD 325.00 |
|
LY415550 | Transient overexpression lysate of paired box 8 (PAX8), transcript variant PAX8C |
USD 325.00 |
|
LY415551 | Transient overexpression lysate of paired box 8 (PAX8), transcript variant PAX8D |
USD 325.00 |
|
LY415574 | Transient overexpression lysate of paired box 8 (PAX8), transcript variant PAX8E |
USD 325.00 |
|
LY429388 | Transient overexpression lysate of paired box 8 (PAX8), transcript variant PAX8D |
USD 325.00 |
|
LY429402 | Transient overexpression lysate of paired box 8 (PAX8), transcript variant PAX8E |
USD 325.00 |
|
PH300651 | PAX8 MS Standard C13 and N15-labeled recombinant protein (NP_003457) |
USD 2,055.00 |
|
PH314188 | PAX8 MS Standard C13 and N15-labeled recombinant protein (NP_039247) |
USD 2,055.00 |
|
PH315690 | PAX8 MS Standard C13 and N15-labeled recombinant protein (NP_054698) |
USD 2,055.00 |
|
TP314188 | Purified recombinant protein of Homo sapiens paired box 8 (PAX8), transcript variant PAX8D |
USD 748.00 |
|
TP315690 | Recombinant protein of human paired box 8 (PAX8), transcript variant PAX8E |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review